KIR2DL4/CD158d Antibody

Images

 
Western Blot: KIR2DL4/CD158d Antibody [H00003805-D01P] - Analysis of KIR2DL4 expression in rat brain.
Western Blot: KIR2DL4/CD158d Antibody [H00003805-D01P] - Analysis of KIR2DL4 expression in transfected 293T cell line by KIR2DL4 polyclonal antibody.Lane 1: KIR2DL4 transfected lysate(41.50 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIR2DL4/CD158d Antibody Summary

Immunogen
KIR2DL4 (AAH41611.1, 1 a.a. - 377 a.a.) full-length human protein. MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHRWCSKKKNAAVMNQEPAGHRTVNREDSDEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETTALSQTQLASSNVPAAGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIR2DL4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KIR2DL4/CD158d Antibody

  • 103AS
  • 15.212
  • CD158 antigen-like family member D
  • CD158d antigen
  • CD158d
  • CD158DKIR103ASKiller cell inhibitory receptor 103AS
  • G9P
  • killer cell immunoglobulin-like receptor 2DL4
  • killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
  • killer Ig receptor
  • KIR103
  • KIR-103AS
  • KIR2DL4
  • MHC class I NK cell receptor KIR103AS
  • natural killer cell inhibitory receptor
  • NK cell receptor

Background

The KIR family consists of transmembrane glycoproteins of the Ig superfamily expressed on human NK cells and a subset of human T cells which they are involved in recognition of either MHC class I molecules or unknown ligand on target cells and inhibit cytotoxic activities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
MAB20172
Species: Hu
Applications: WB, CyTOF-reported, Neut
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
AF2225
Species: Mu
Applications: WB, Flow, AgAct, CyTOF-ready
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NBP1-76983
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB1844
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for KIR2DL4/CD158d Antibody (H00003805-D01P) (0)

There are no publications for KIR2DL4/CD158d Antibody (H00003805-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIR2DL4/CD158d Antibody (H00003805-D01P) (0)

There are no reviews for KIR2DL4/CD158d Antibody (H00003805-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIR2DL4/CD158d Antibody (H00003805-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIR2DL4/CD158d Products

Bioinformatics Tool for KIR2DL4/CD158d Antibody (H00003805-D01P)

Discover related pathways, diseases and genes to KIR2DL4/CD158d Antibody (H00003805-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIR2DL4/CD158d Antibody (H00003805-D01P)

Discover more about diseases related to KIR2DL4/CD158d Antibody (H00003805-D01P).
 

Pathways for KIR2DL4/CD158d Antibody (H00003805-D01P)

View related products by pathway.

PTMs for KIR2DL4/CD158d Antibody (H00003805-D01P)

Learn more about PTMs related to KIR2DL4/CD158d Antibody (H00003805-D01P).

Blogs on KIR2DL4/CD158d

There are no specific blogs for KIR2DL4/CD158d, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIR2DL4/CD158d Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIR2DL4
Entrez
Uniprot