Kir2.1 Recombinant Protein Antigen

Images

 
There are currently no images for Kir2.1 Protein (NBP1-87709PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kir2.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNJ2.

Source: E. coli

Amino Acid Sequence: YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNJ2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87709.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kir2.1 Recombinant Protein Antigen

  • ATFB9
  • Cardiac inward rectifier potassium channel
  • HHBIRK1
  • HHIRK1
  • HIRK1
  • Inward rectifier K(+) channel Kir2.1
  • inward rectifier K+ channel KIR2.1
  • inward rectifier potassium channel 2
  • IRK1
  • IRK-1
  • IRK1LQT7
  • KCNJ2
  • Kir2.1
  • LQT7
  • Potassium channel, inwardly rectifying subfamily J member 2
  • potassium inwardly-rectifying channel, subfamily J, member 2
  • SQT3

Background

FUNCTION: Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium or cesium.; Tissue specificity: Heart, brain, placenta, lung, skeletal muscle, and kidney. Diffusely distributed throughout the brain.; Subcellular location: Membrane, Multi-pass membrane protein.; Involvement in disease: Defects in KCNJ2 are the cause of long QT syndrome type 7 (LQT7); also called Andersen syndrome or Andersen cardiodysrhythmic periodic paralysis. Long QT syndromes are heart disorders characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to excercise or emotional stress. LQT7 manifests itself as a clinical triad consisting of potassium-sensitive periodic paralysis, ventricular ectopy and dysmorphic features.; Defects in KCNJ2 are the cause of short QT syndrome type 3 (SQT3). Short QT syndromes are heart disorders characterized by idiopathic persistently and uniformly short QT interval on ECG in the absence of structural heart disease in affected individuals. They cause syncope and sudden death. SQT3 has a unique ECG phenotype characterized by asymmetrical T waves.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03005
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP2-87693
Species: Hu
Applications: IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-01702
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-61010
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, RIA, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP1-88081
Species: Hu
Applications: IHC, IHC-P, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NB100-74575
Species: Hu
Applications: ICC/IF, IHC, PEP-ELISA, WB
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87709PEP
Species: Hu
Applications: AC

Publications for Kir2.1 Protein (NBP1-87709PEP) (0)

There are no publications for Kir2.1 Protein (NBP1-87709PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir2.1 Protein (NBP1-87709PEP) (0)

There are no reviews for Kir2.1 Protein (NBP1-87709PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kir2.1 Protein (NBP1-87709PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kir2.1 Products

Array NBP1-87709PEP

Research Areas for Kir2.1 Protein (NBP1-87709PEP)

Find related products by research area.

Blogs on Kir2.1

There are no specific blogs for Kir2.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kir2.1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ2