Kinesin 5B Recombinant Protein Antigen

Images

 
There are currently no images for Kinesin 5B Recombinant Protein Antigen (NBP2-58450PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kinesin 5B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Kinesin 5B.

Source: E. coli

Amino Acid Sequence: ETVPIDEQFDKEKANLEAFTVDKDITLTNDKPATAIGVIGNFTDAERRKCEEEIAKLYKQLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF5B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58450.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kinesin 5B Recombinant Protein Antigen

  • Conventional kinesin heavy chain
  • kinesin family member 5B
  • kinesin-1 heavy chain
  • KNS1kinesin 1 (110-120kD)
  • KNSKINH
  • Ubiquitous kinesin heavy chain
  • UKHCkinesin heavy chain

Background

KIF5B is a kinesin. These are microtubule based motor proteins involved in the transport of organelles in eukaryotic cells. They typically consist of 2 identical, approximately 110 to 120 kD heavy chains and 2 identical, approximately 60 to 70 kD light chains. The heavy chain contains 3 domains: a globular N terminal motor domain, which converts the chemical energy of ATP into a motile force along microtubules in 1 fixed direction; a central alpha helical rod domain, which enables the 2 heavy chains to dimerize; and a globular C terminal domain, which interacts with light chains and possibly an organelle receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-22348
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
NBP1-76816
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-87429
Species: Hu
Applications: IHC,  IHC-P, WB
AF4210
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-05030
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-86805
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-83936
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38794
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NB500-180
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
AF1205
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-83722
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-45743
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
AF482
Species: Mu
Applications: IHC, WB

Publications for Kinesin 5B Recombinant Protein Antigen (NBP2-58450PEP) (0)

There are no publications for Kinesin 5B Recombinant Protein Antigen (NBP2-58450PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kinesin 5B Recombinant Protein Antigen (NBP2-58450PEP) (0)

There are no reviews for Kinesin 5B Recombinant Protein Antigen (NBP2-58450PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kinesin 5B Recombinant Protein Antigen (NBP2-58450PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kinesin 5B Products

Research Areas for Kinesin 5B Recombinant Protein Antigen (NBP2-58450PEP)

Find related products by research area.

Blogs on Kinesin 5B

There are no specific blogs for Kinesin 5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kinesin 5B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF5B