Kindlin Antibody


Immunohistochemistry: Kindlin Antibody [NBP1-89884] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Kindlin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLA
Specificity of human Kindlin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kindlin Protein (NBP1-89884PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kindlin Antibody

  • C20orf42fermitin family homolog 1
  • chromosome 20 open reading frame 42
  • fermitin family homolog 1 (Drosophila)
  • fermitin family member 1
  • FLJ20116
  • kindlerin
  • kindlin 1
  • Kindlin syndrome protein
  • Kindlin-1
  • UNC112 related protein 1
  • UNC112A
  • Unc-112-related protein 1
  • URP1FLJ23423


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Kindlin Antibody (NBP1-89884) (0)

There are no publications for Kindlin Antibody (NBP1-89884).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kindlin Antibody (NBP1-89884) (0)

There are no reviews for Kindlin Antibody (NBP1-89884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kindlin Antibody (NBP1-89884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kindlin Products

Bioinformatics Tool for Kindlin Antibody (NBP1-89884)

Discover related pathways, diseases and genes to Kindlin Antibody (NBP1-89884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kindlin Antibody (NBP1-89884)

Discover more about diseases related to Kindlin Antibody (NBP1-89884).

Pathways for Kindlin Antibody (NBP1-89884)

View related products by pathway.

PTMs for Kindlin Antibody (NBP1-89884)

Learn more about PTMs related to Kindlin Antibody (NBP1-89884).

Blogs on Kindlin

There are no specific blogs for Kindlin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kindlin Antibody and receive a gift card or discount.


Gene Symbol FERMT1