KIFC3 Antibody

Images

 
Western Blot: KIFC3 Antibody [NBP1-58178] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIFC3 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIFC3(kinesin family member C3) The peptide sequence was selected from the C terminal of KIFC3 (NP_005541). Peptide sequence EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIFC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KIFC3 and was validated on Western blot.
Theoretical MW
93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
KIFC3 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIFC3 Antibody

  • DKFZp686D23201
  • FLJ34694
  • kinesin family member C3
  • kinesin-like protein KIFC3

Background

KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58193
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-58450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr, Pl
Applications: WB, IB, ICC/IF, IP
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB100-40844
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-58126
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC
NBP1-87947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP1-76816
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: IHC, IHC-P
NBP2-30627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76328
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80033
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB
NBP1-56853
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-98441
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5458
Species: Hu
Applications: WB, ICC

Publications for KIFC3 Antibody (NBP1-58178) (0)

There are no publications for KIFC3 Antibody (NBP1-58178).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIFC3 Antibody (NBP1-58178) (0)

There are no reviews for KIFC3 Antibody (NBP1-58178). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIFC3 Antibody (NBP1-58178) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KIFC3 Products

Bioinformatics Tool for KIFC3 Antibody (NBP1-58178)

Discover related pathways, diseases and genes to KIFC3 Antibody (NBP1-58178). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIFC3 Antibody (NBP1-58178)

Discover more about diseases related to KIFC3 Antibody (NBP1-58178).
 

Pathways for KIFC3 Antibody (NBP1-58178)

View related products by pathway.

PTMs for KIFC3 Antibody (NBP1-58178)

Learn more about PTMs related to KIFC3 Antibody (NBP1-58178).

Blogs on KIFC3

There are no specific blogs for KIFC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIFC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIFC3
Entrez
Uniprot