KIF7 Antibody

Images

 
Immunohistochemistry-Paraffin: KIF7 Antibody [NBP1-92056] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MWINQELKQKLGGVNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIF7 Protein (NBP1-92056PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF7 Antibody

  • EQYK340
  • kinesin family member 7
  • kinesin-like protein KIF7
  • MGC120653
  • MGC138476
  • MGC138478
  • UNQ340

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIF7 Antibody (NBP1-92056) (0)

There are no publications for KIF7 Antibody (NBP1-92056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF7 Antibody (NBP1-92056) (0)

There are no reviews for KIF7 Antibody (NBP1-92056). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIF7 Antibody (NBP1-92056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF7 Products

Research Areas for KIF7 Antibody (NBP1-92056)

Find related products by research area.

Blogs on KIF7

There are no specific blogs for KIF7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF7