KIF7 Antibody

Images

 
Immunohistochemistry-Paraffin: KIF7 Antibody [NBP1-92056] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MWINQELKQKLGGVNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGE
Specificity
Specificity of human KIF7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIF7 Protein (NBP1-92056PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF7 Antibody

  • EQYK340
  • kinesin family member 7
  • kinesin-like protein KIF7
  • MGC120653
  • MGC138476
  • MGC138478
  • UNQ340

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-01756
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
1705-HH/CF
Species: Hu, Mu
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-87384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
9134-TN
Species: Hu
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-81721
Species: Hu, Mu, Rt, Gp(-)
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF196
Species: Mu
Applications: WB, IHC
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-92056
Species: Hu
Applications: IHC, IHC-P

Publications for KIF7 Antibody (NBP1-92056) (0)

There are no publications for KIF7 Antibody (NBP1-92056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF7 Antibody (NBP1-92056) (0)

There are no reviews for KIF7 Antibody (NBP1-92056). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIF7 Antibody (NBP1-92056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF7 Products

Bioinformatics Tool for KIF7 Antibody (NBP1-92056)

Discover related pathways, diseases and genes to KIF7 Antibody (NBP1-92056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF7 Antibody (NBP1-92056)

Discover more about diseases related to KIF7 Antibody (NBP1-92056).
 

Pathways for KIF7 Antibody (NBP1-92056)

View related products by pathway.

PTMs for KIF7 Antibody (NBP1-92056)

Learn more about PTMs related to KIF7 Antibody (NBP1-92056).

Blogs on KIF7

There are no specific blogs for KIF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF7