Kif2a Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Kif2a Antibody [NBP2-55116] - Staining of human cell line A549 shows localization to nucleus, nucleoli & centrosome. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kif2a Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TAAGDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRA
Specificity
Specificity of human Kif2a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF2A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Kif2a Recombinant Protein Antigen (NBP2-55116PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Kif2a Antibody

  • HK2
  • KIF2kinesin-2
  • kinesin heavy chain member 2
  • kinesin heavy chain member 2A
  • Kinesin, heavy chain, 2
  • Kinesin-2
  • kinesin-like protein KIF2A
  • KNS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, S-ELISA
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
AF7928
Species: Mu
Applications: WB, IHC
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-81990
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-75552
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-76942
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01833
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90295
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Kif2a Antibody (NBP2-55116) (0)

There are no publications for Kif2a Antibody (NBP2-55116).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kif2a Antibody (NBP2-55116) (0)

There are no reviews for Kif2a Antibody (NBP2-55116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Kif2a Antibody (NBP2-55116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Kif2a Products

Bioinformatics Tool for Kif2a Antibody (NBP2-55116)

Discover related pathways, diseases and genes to Kif2a Antibody (NBP2-55116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kif2a Antibody (NBP2-55116)

Discover more about diseases related to Kif2a Antibody (NBP2-55116).
 

Pathways for Kif2a Antibody (NBP2-55116)

View related products by pathway.

PTMs for Kif2a Antibody (NBP2-55116)

Learn more about PTMs related to Kif2a Antibody (NBP2-55116).
 

Research Areas for Kif2a Antibody (NBP2-55116)

Find related products by research area.

Blogs on Kif2a.

Kif2a and MT-Destabilization during Mitosis
Kif2a belongs to the Kinesin-13 microtubule depolymerase family that includes members Kif2a, Kif2b, and Kif2c. These proteins are capable of depolymerizing microtubules (MTs) at their ends. During mitotic cell division, Kif2a specifically localizes to...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kif2a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF2A