KIBRA Antibody

Images

 
Western Blot: KIBRA Antibody [NBP2-87683] - WB Suggested Anti-WWC1 Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole Cell

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Eq, GpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIBRA Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIBRA. Peptide sequence: SRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLEDSW The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Equine (100%), Bovine (93%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
WWC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIBRA Antibody

  • FLJ10865
  • FLJ23369
  • HBeAg-binding protein 3
  • KIAA0869HBEBP3
  • KIBRAHBEBP36
  • Kidney and brain protein
  • protein KIBRA
  • protein WWC1
  • WW and C2 domain containing 1
  • WW domain-containing protein 1
  • WW, C2 and coiled-coil domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5480
Species: Hu
Applications: IHC
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
MAB7940
Species: Hu
Applications: WB, IHC
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00060485-M02
Species: Hu, Mu, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-81763
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86860
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-1354
Species: Hu
Applications: Flow, PEP-ELISA, IF
NBP3-03913
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88882
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-87683
Species: Hu, Mu, Rt, Bv, Eq, Gp
Applications: WB

Publications for KIBRA Antibody (NBP2-87683) (0)

There are no publications for KIBRA Antibody (NBP2-87683).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIBRA Antibody (NBP2-87683) (0)

There are no reviews for KIBRA Antibody (NBP2-87683). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIBRA Antibody (NBP2-87683) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KIBRA Products

Bioinformatics Tool for KIBRA Antibody (NBP2-87683)

Discover related pathways, diseases and genes to KIBRA Antibody (NBP2-87683). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIBRA Antibody (NBP2-87683)

Discover more about diseases related to KIBRA Antibody (NBP2-87683).
 

Pathways for KIBRA Antibody (NBP2-87683)

View related products by pathway.

PTMs for KIBRA Antibody (NBP2-87683)

Learn more about PTMs related to KIBRA Antibody (NBP2-87683).

Blogs on KIBRA

There are no specific blogs for KIBRA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIBRA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WWC1