Recombinant Human Ki-67/MKI67 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Ki-67/MKI67 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 3157-3256 of Human Ki-67/MKI67

Source: Wheat Germ

Amino Acid Sequence: RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MKI67
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ki-67/MKI67 Protein

  • antigen identified by monoclonal Ki-67
  • antigen KI-67
  • Ki67
  • Ki-67
  • KIA
  • Marker Of Proliferation Ki-67
  • MIB-1
  • MKI67
  • PPP1R105
  • proliferation-related Ki-67 antigen
  • Protein Phosphatase 1
  • Regulatory Subunit 105
  • TSG126

Background

MKI67 - antigen identified by monoclonal antibody Ki-67

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
H00004288-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01) (0)

There are no publications for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01) (0)

There are no reviews for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01). (Showing 1 - 2 of 2 FAQ).

  1. Can I know the species of GST tag of Ki67 Partial Recombinant Protein (H00004288-Q01).
    • H00004288-Q01 is human protein that was expressed in a wheat germ system.
  2. I recently purchased Ki67 Partial Recombinant Protein (H00004288-Q01) from your company. The protein will be used screening of RNA pool. It is very crucial to screen in advance against GST epitope tag protein before Ki67 screening. So I wish to buy GST Epitope tag protein with is the same as GST tag of Ki67. Please let me know the product name among the GST tag proteins in your catalog.
    • We distribute H00004288-Q01 for Abnova, a company based in Taiwan, and are not involved in the development of this product. Abnova considers the sequence of the GST tag that they use for their recombinant proteins proprietary, but we do sell a number of GST epitope tag proteins.

Additional Ki-67/MKI67 Products

Bioinformatics Tool for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01)

Discover related pathways, diseases and genes to Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01)

Discover more about diseases related to Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01).
 

Pathways for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01)

View related products by pathway.

PTMs for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01)

Learn more about PTMs related to Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01).
 

Research Areas for Ki-67/MKI67 Partial Recombinant Protein (H00004288-Q01)

Find related products by research area.

Blogs on Ki-67/MKI67.

The relationship between Ki67 and HIF-1 in cancer
Ki67, also known as MKI67, is best known as the leading marker of cellular proliferation. Ki67 is regulated by a balance between synthesis and degradation, and often carries a very short half-life.  First discovered to be located to dividing cells,...  Read full blog post.

Ki67 - an established marker for labelling proliferating cells
Ki-67/MKI67 is an antigen which is expressed during G1, S, G2, and M phases of the cell cycle (mitotically active cells), but not during G0 phase (resting cells). It is a large protein with expected molecular weight of about 395 kDa, and it has a v...  Read full blog post.

Ki67 - A Crucial Cellular Proliferation Marker
The Ki67 antigen is a prototypic cell cycle-related protein expressed by proliferating cells in all phases of the active cell cycle (G1, S, G2 and M). It is a non-histone nuclear protein originally identified in a Hodgkin's lymphoma-derived cell line....  Read full blog post.

The Ki67 Antibody in Cell Marker Studies
The MK167, or Ki67 antibody recognizes a nuclear protein encoded by the MK167 gene. Ki167 is involved with RNA transcription and essential to cellular proliferation, being expressed by proliferating cells at all stages of the active cell cycle; it is...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ki-67/MKI67 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MKI67
Entrez