KDM2A/FBXL11 Antibody - BSA Free

Western Blot: KDM2A/FBXL11 Antibody [NBP2-86693] - WB Suggested Anti-FBXL11 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate

Immunohistochemistry: KDM2A/FBXL11 Antibody [NBP2-86693] - HumanMuscle

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KDM2A/FBXL11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KDM2A/FBXL11 Antibody - BSA Free (NBP2-86693) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human FBXL11. Peptide sequence: RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KDM2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KDM2A/FBXL11 Antibody - BSA Free

• [Histone-H3]-lysine-36 demethylase 1A
• CXXC8
• CXXC8F-box protein FBL7
• CXXC-type zinc finger protein 8
• EC 1.14.11.27
• FBL11
• FBL11DKFZp434M1735
• FBL7
• FBL7F-box protein Lilina
• F-box and leucine-rich repeat protein 11DKFZP434M1735
• F-box protein FBL11
• F-box protein FBL7
• FBXL11
• FBXL11FLJ46431
• FLJ00115
• JHDM1A
• JHDM1AF-box/LRR-repeat protein 11
• JmjC domain-containing histone demethylation protein 1A
• jumonji C domain-containing histone demethylase 1A
• KDM2A
• KDM2A/FBXL11
• KIAA1004
• KIAA1004EC 1.14.11.27
• LILINA
• lysine (K)-specific demethylase 2A
• lysine-specific demethylase 2A
• SF-KDM2A

Background

KDM2A/FBXL11 (F-box and leucine-rich repeat protein 11) is a histone demethylase which has an important role in histone code as well as epigenetic silencing. KDM2A/FBXL11 is known to have interactions with SMAD7, SMAD3, ZNF512B, HIST2H3A and HIST2H3C. KDM2A/FBXL11 has been studied in relation to anemia and Fanconi's anemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KDM2A