KDM2A/FBXL11 Antibody

Images

 
Western Blot: KDM2A/FBXL11 Antibody [NBP2-86693] - WB Suggested Anti-FBXL11 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Immunohistochemistry: KDM2A/FBXL11 Antibody [NBP2-86693] - HumanMuscle

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KDM2A/FBXL11 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human FBXL11. Peptide sequence: RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTF The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%), Zebrafish (93%), Canine (100%), Equine (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
KDM2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KDM2A/FBXL11 Antibody

  • [Histone-H3]-lysine-36 demethylase 1A
  • CXXC8F-box protein FBL7
  • CXXC-type zinc finger protein 8
  • FBL11DKFZp434M1735
  • FBL7F-box protein Lilina
  • F-box and leucine-rich repeat protein 11DKFZP434M1735
  • F-box protein FBL11
  • FBXL11FLJ46431
  • FLJ00115
  • JHDM1AF-box/LRR-repeat protein 11
  • JmjC domain-containing histone demethylation protein 1A
  • jumonji C domain-containing histone demethylase 1A
  • KIAA1004EC 1.14.11.27
  • LILINA
  • lysine (K)-specific demethylase 2A
  • lysine-specific demethylase 2A
  • SF-KDM2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00084678-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NBP2-45603
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1744
Species: Hu
Applications: IHC, IHC-P
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-67706
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-92895
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP1-76491
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
AF1195
Species: Hu
Applications: WB, ELISA, IHC, Neut
NB100-56519
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
NBP2-15135
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD

Publications for KDM2A/FBXL11 Antibody (NBP2-86693) (0)

There are no publications for KDM2A/FBXL11 Antibody (NBP2-86693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KDM2A/FBXL11 Antibody (NBP2-86693) (0)

There are no reviews for KDM2A/FBXL11 Antibody (NBP2-86693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KDM2A/FBXL11 Antibody (NBP2-86693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KDM2A/FBXL11 Products

Bioinformatics Tool for KDM2A/FBXL11 Antibody (NBP2-86693)

Discover related pathways, diseases and genes to KDM2A/FBXL11 Antibody (NBP2-86693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KDM2A/FBXL11 Antibody (NBP2-86693)

Discover more about diseases related to KDM2A/FBXL11 Antibody (NBP2-86693).
 

Pathways for KDM2A/FBXL11 Antibody (NBP2-86693)

View related products by pathway.

PTMs for KDM2A/FBXL11 Antibody (NBP2-86693)

Learn more about PTMs related to KDM2A/FBXL11 Antibody (NBP2-86693).
 

Research Areas for KDM2A/FBXL11 Antibody (NBP2-86693)

Find related products by research area.

Blogs on KDM2A/FBXL11

There are no specific blogs for KDM2A/FBXL11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KDM2A/FBXL11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM2A