Home » KDM2A/FBXL11 » KDM2A/FBXL11 Antibodies » KDM2A/FBXL11 Antibody

KDM2A/FBXL11 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: KDM2A/FBXL11 Antibody [NBP2-86693] - WB Suggested Anti-FBXL11 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Western Blot: KDM2A/FBXL11 Antibody [NBP2-86693] - WB Suggested Anti-FBXL11 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Immunohistochemistry: KDM2A/FBXL11 Antibody [NBP2-86693] - HumanMuscle

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

KDM2A/FBXL11 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human FBXL11. Peptide sequence: RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTF The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%), Zebrafish (93%), Canine (100%), Equine (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
KDM2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KDM2A/FBXL11 Antibody

  • [Histone-H3]-lysine-36 demethylase 1A
  • CXXC8F-box protein FBL7
  • CXXC-type zinc finger protein 8
  • FBL11DKFZp434M1735
  • FBL7F-box protein Lilina
  • F-box and leucine-rich repeat protein 11DKFZP434M1735
  • F-box protein FBL11
  • FBXL11FLJ46431
  • FLJ00115
  • JHDM1AF-box/LRR-repeat protein 11
  • JmjC domain-containing histone demethylation protein 1A
  • jumonji C domain-containing histone demethylase 1A
  • KIAA1004EC 1.14.11.27
  • LILINA
  • lysine (K)-specific demethylase 2A
  • lysine-specific demethylase 2A
  • SF-KDM2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

KDM2B Antibody
(5G1)
H00084678-M09
Western Blot: KDM2B Antibody (5G1) [H00084678-M09] - Western Blot analysis of FBXL10 expression in Hela NE ( Cat # L013V3 ).
Immunocytochemistry/Immunofluorescence: KDM2B Antibody (5G1) [H00084678-M09] - Analysis of monoclonal antibody to FBXL10 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: KDM2B Antibody (5G1) [H00084678-M09] - Detection limit for recombinant GST tagged FBXL10 is approximately 0.1ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
MBD2 Antibody
NB100-81657
Western Blot: MBD2 Antibody [NB100-81657] - Detection of Human and Mouse MBD2 on HeLa whole cell lysate using NB100-81657. MBD2 was also immunoprecipitated by rabbit anti-MBD2 antibody NB100-81656.
Immunohistochemistry-Paraffin: MBD2 Antibody [NB100-81657] - Section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-MBD2 used at a dilution of 1:200 (1ug/ml). Detection: DAB
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Western Blot: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CDKN2B.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by CDKN2B antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(44 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
KMT3B/NSD1 Antibody
NB100-1744
Immunohistochemistry-Paraffin: KMT3B/NSD1 Antibody [NB100-1744] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-NSD1 used at a dilution of 1:250. Detection: DAB staining using Immunohistochemistry Accessory Kit.
Immunohistochemistry-Paraffin: KMT3B/NSD1 Antibody [NB100-1744] - Sample : FFPE section of human prostate adenocarcinoma. Antibody: Affinity purified rabbit anti-NSD1 used at a dilution of 1:250. Detection: DAB
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
LSD1 Antibody
(1B2E5)
NB100-1762
Western Blot: LSD1 Antibody (1B2E5) [NB100-1762] - KDM1A is strongly overexpressed in human medulloblastomas, cell lines derived from them and murine medulloblastic tumors. Strong KDM1A protein expression was confirmed in the medulloblastic tumors from SmoA1-and Ptch+/A-mice relative to KDM1A expression in cerebellar tissue (CB) using western blotting of tissue lysates. I2-actin expression was used as a loading control. Image collected and cropped by Cite Ab from the following publication (The KDM1A histone demethylase is a promising new target for the epigenetic therapy of medulloblastoma. Acta Neuropathol Commun (2013)) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LSD1 Antibody (1B2E5) [NB100-1762] - KDM1A is strongly overexpressed in human medulloblastomas, cell lines derived from them and murine medulloblastic tumors. KDM1A protein expresion was evaluated immunohistochemically in a tissue microarray of 70 medulloblastomas (MB) and 9 tissue samples of normal cerebellum (CB). Micrograph showing KDM1A-positive staining in a representative MB sample, and KDM1A-negative staining in CB, scale bar=100AI1/4m. Image collected and cropped by Cite Ab from the following publication (The KDM1A histone demethylase is a promising new target for the epigenetic therapy of medulloblastoma. Acta Neuropathol Commun (2013)) licensed under a CC-BY licence.
Western Blot: LSD1 Antibody (1B2E5) [NB100-1762] - Western blot analysis using LSD1 mouse mAb against COS (1), Hela (2), NIH/3T3 (3), A549 (4) and Jurkat (5) cell lysate.
(11 Publications)
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(4 Publications)
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Cytokeratin 4
Antibody (SN74-03)
NBP2-67706
Immunocytochemistry/Immunofluorescence: Cytokeratin 4 Antibody (SN74-03) [NBP2-67706] - Staining Cytokeratin 4 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytokeratin 4 Antibody (SN74-03) [NBP2-67706] - Analysis of paraffin-embedded human tonsil tissue using anti-Cytokeratin 4 antibody. Counter stained with hematoxylin.
Flow Cytometry: Cytokeratin 4 Antibody (SN74-03) [NBP2-67706] - Analysis of A431 cells with Cytokeratin 4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
CXXC1 Antibody
NBP2-92895
Western Blot: CXXC1 Antibody [NBP2-92895] - Analysis of extracts of various cell lines, using CXXC1.Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: CXXC1 Antibody [NBP2-92895] - Analysis of A549 cells using CXXC1. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-92895] - Paraffin-embedded mouse lung using CXXC1.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MBD1 Antibody
(100B272.1)
NB100-56537
Knockdown Validated: MBD1 Antibody (100B272.1) [NB100-56537] - blot shows lysates of HEK293T human embryonic kidney parental cell line and MBD1 knockout (KO) HEK293T cell line. PVDF membrane was probed with 2.0 ug/ml of Mouse Anti-Human MBD1 Monoclonal Antibody (Catalog # NB100-56537) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for MBD1 at approximately 60 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in the knockout HEK293T cell line. This experiment was conducted under reducing conditions.
Western Blot: MBD1 Antibody (100B272.1) [NB100-56537] - Analysis using Azide and BSA Free version of NB100-56537. Jurkat cell lysate using anti-MBD1 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MBD1 Antibody (100B272.1) [NB100-56537] - NIH3T3 cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-MBD1 (100B272.1) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
CXXC4 Antibody
NBP1-76491
Western Blot: CXXC4 Antibody [NBP1-76491] - Human brain tissue lysate with CXXC4 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry-Paraffin: CXXC4 Antibody [NBP1-76491] - Human brain tissue with CXXC4 antibody at 10 ug/mL.
Immunofluorescence: CXXC4 Antibody [NBP1-76491] - Immunofluorescence of CXXC4 in human brain tissue with CXXC4 antibody at 20 ug/mL.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
A20/TNFAIP3
Antibody (59A426)
NBP1-77533
Western Blot: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - Human Jurkat lysate probed with A20 antibody at 4 ug/ml.
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on SK-MEL-28 cells with A20/TNFAIP3 (59A426) antibody NBP1-77533AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Simple Western: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - Lane view shows a specific band for A20/TNFAIP3 in 0.05 mg/ml of Jurkat lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(40 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Epiregulin
Antibody [Unconjugate
AF1195
Epiregulin Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: WB, ELISA, IHC, Neut
DNMT1 Antibody
(60B1220.1)
NB100-56519
Western Blot: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of Dnmt1 in 2102EP (human embryonic carcinoma) in the A) absence and B) presence of immunizing peptide, recombinant human Dnmt1 protein in the C) absence and D) presence of immunizing peptide, NIH 3T3 (mouse embryonic fribroblast) in the E) absence and F) presence of immunizing peptide, and D3 (mouse embryonic stem cell) in the G) absence and H) presence of immunizing peptide using Dnmt1 antibody. this antibody. 5 ug/ml for testing the human cell line and 0.1 ug/ml was used for testing the recombinant protein and the mouse cell lines. ’s goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: DNMT1 Antibody (60B1220.1) [NB100-56519] - Dnmt1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). Antibody dilution of 1:10 was used. Image objective 40x.
Immunohistochemistry-Paraffin: DNMT1 Antibody (60B1220.1) [NB100-56519] - Tissue section of human hepatocellular carcinoma at 1:50 dilution.
(4 Reviews)
(120 Publications)
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Immunofluorescence indicates NF-kB p65 subunit was expressed exclusively in AA-G groups and AST-G cytoplasm. High glucose stimulation impact on TSMCs in NF-kB pathway. (A) NF-kB p65 protein subunit expression in TSMCs in each group. (B) NF-kB p65 subunit immunofluorescence. Each number denotes different subunits. Alexa 488 green served as secondary antibodies.Citation: Hara K, Hamada C, Wakabayashi K, Kanda R, Kaneko K, Horikoshi S, et al. (2017) Scavenging of reactive oxygen species by astaxanthin inhibits epithelial-mesenchymal transition in high glucose-stimulated mesothelial cells. PLoS ONE 12(9): e0184332. https://doi.org/10.1371/journal.pone.0184332
(85 Publications)
Species: Hu, Mu, Rt
TET1 Antibody
(1462)
NBP2-15135
Western Blot: TET1 Antibody (1462) [NBP2-15135] - A. 30 ug 293T whole cell lysate/extract B. 30 ug whole cell lysate/extract of DDDDK-human TET1-transfected 293T cells 5 % SDS-PAGE TET1 antibody dilution: 1:500
Immunocytochemistry/Immunofluorescence: TET1 Antibody (GT1462) [NBP2-15135] - detects TET1 protein at nucleus by immunofluorescent analysis. Sample: TET1-transfected (right) or untransfected (left) 293T cells were fixed in 4% paraformaldehyde for 15 min. Green: TET1 protein stained by TET1 antibody diluted at 1:1000. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: TET1 Antibody (1462) [NBP2-15135] - Detects TET1 protein at nucleus on HeLa xenograft by immunohistochemical analysis. Sample: Paraffin- Embedded HeLa xenograft. Dilution: 1:100
(1 Publication)
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD

Publications for KDM2A/FBXL11 Antibody (NBP2-86693) (0)

There are no publications for KDM2A/FBXL11 Antibody (NBP2-86693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KDM2A/FBXL11 Antibody (NBP2-86693) (0)

There are no reviews for KDM2A/FBXL11 Antibody (NBP2-86693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KDM2A/FBXL11 Antibody (NBP2-86693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional KDM2A/FBXL11 Products

Bioinformatics Tool for KDM2A/FBXL11 Antibody (NBP2-86693)

Discover related pathways, diseases and genes to KDM2A/FBXL11 Antibody (NBP2-86693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KDM2A/FBXL11 Antibody (NBP2-86693)

Discover more about diseases related to KDM2A/FBXL11 Antibody (NBP2-86693).
 

Pathways for KDM2A/FBXL11 Antibody (NBP2-86693)

View related products by pathway.

PTMs for KDM2A/FBXL11 Antibody (NBP2-86693)

Learn more about PTMs related to KDM2A/FBXL11 Antibody (NBP2-86693).
 

Research Areas for KDM2A/FBXL11 Antibody (NBP2-86693)

Find related products by research area.

Blogs on KDM2A/FBXL11

There are no specific blogs for KDM2A/FBXL11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KDM2A/FBXL11 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KDM2A