KCTD7 Antibody - BSA Free

Western Blot: KCTD7 Antibody [NBP1-80094] - Host: Rabbit. Target Name: KCTD7. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: KCTD7 Antibody [NBP1-80094] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KCTD7 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human KCTD7 containing the following sequence: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. Peptide sequence VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCTD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCTD7 Antibody - BSA Free

• BTB/POZ domain-containing protein KCTD7
• EPM3FLJ32069
• FLJ45891
• potassium channel tetramerisation domain containing 7

Background

The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels (see KCNA1; MIM 176260). KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain (Van Bogaert et al., 2007 [PubMed 17455289]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for KCTD7 Antibody (NBP1-80094). (Showing 1 - 1 of 1 FAQ).

1. We recently purchased NBP1-80094 and would like to generate a blocking peptide. Could you tell me the peptide that was used to generate the antibody?
   • The peptide sequence used to synthesize the antibody is as follows: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE

Bioinformatics

• Gene Symbol: KCTD7
• Uniprot:
  • NP_694578(Human)