Tripeptidyl-Peptidase I/TPP1 Antibody

Images

 
Immunohistochemistry: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP1-85561] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tripeptidyl-Peptidase I/TPP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPSYQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tripeptidyl-Peptidase I/TPP1 Protein (NBP1-85561PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tripeptidyl-Peptidase I/TPP1 Antibody

  • Cell growth-inhibiting gene 1 protein
  • ceroid-lipofuscinosis, neuronal 2, late infantile (Jansky-Bielschowsky disease)
  • CLN2
  • CLN2EC 3.4.14.9
  • growth-inhibiting protein 1
  • LINCL
  • LPIC
  • lysosomal pepstatin insensitive protease
  • Lysosomal pepstatin-insensitive protease
  • MGC21297
  • TPP1
  • TPP-1
  • TPP-I
  • Tripeptidyl aminopeptidase
  • tripeptidyl peptidase I
  • tripeptidyl-peptidase 1
  • TripeptidylPeptidase I
  • Tripeptidyl-Peptidase I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43782
Species: Hu
Applications: WB
NBP1-87974
Species: Hu
Applications: WB, IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NB500-176
Species: Hu
Applications: WB
NBP1-94150
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP2-39066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91333
Species: Hu
Applications: WB
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85561
Species: Hu
Applications: IHC, IHC-P

Publications for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561) (0)

There are no publications for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561) (0)

There are no reviews for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tripeptidyl-Peptidase I/TPP1 Products

Bioinformatics Tool for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561)

Discover related pathways, diseases and genes to Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561)

Discover more about diseases related to Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561).
 

Pathways for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561)

View related products by pathway.

PTMs for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561)

Learn more about PTMs related to Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561).
 

Research Areas for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP1-85561)

Find related products by research area.

Blogs on Tripeptidyl-Peptidase I/TPP1

There are no specific blogs for Tripeptidyl-Peptidase I/TPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tripeptidyl-Peptidase I/TPP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPP1
Entrez