KCNK1 Antibody (4D7) - Azide and BSA Free

Western Blot: KCNK1 Antibody (4D7) [H00003775-M01-100ug] - Detection against Immunogen (33.66 KDa) .

ELISA: KCNK1 Antibody (4D7) [H00003775-M01-100ug] - Detection limit for recombinant GST tagged KCNK1 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KCNK1 Antibody (4D7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse KCNK1 Antibody (4D7) - Azide and BSA Free (H00003775-M01-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: KCNK1 (NP_002236.1, 265 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KCNK1
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCNK1 Antibody (4D7) - Azide and BSA Free

• DPK
• HOHO1
• Inward rectifying potassium channel protein TWIK-1
• K2P1
• K2p1.1
• KCNK1
• KCNO1
• Potassium channel KCNO1
• potassium channel subfamily K member 1
• potassium channel, subfamily K, member 1
• potassium inwardly-rectifying channel, subfamily K, member 1
• TWIK1
• TWIK-1
• TWIK1HOHO

Background

K+ channels are divided into three subclasses, reflecting the number of transmembrane segments (TMS), which are designated 6TMS, 4TMS and 2TMS. Members of the 4TMS class contain two distinct pore regions, and include TASK, TREK, TRAAK and TWIK. TWIK-1 mRNA is expressed abundantly in brain and at lower levels in lung, kidney and skeletal muscle. The molecular weight of TWIK-1 in mouse brain is 40 kDa under reducing conditions. TWIK-2 shares low sequence homology with other mammalian family group members, and only 34% homology with TWIK-1. Human TWIK-2 is expressed in pancreas, placenta and heart, while mouse TWIK-2 is expressed in liver. TWIK-2 is inhibited by intracellular, but not extracellular, acidification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNK1
• Entrez:
  • 3775(Human)
• OMIM:
  • 601745(Human)
• Uniprot:
  • NP_002236.1(Human)