KCNJ15 Antibody (1B2) - Azide and BSA Free

Western Blot: KCNJ15 Antibody (1B2) [H00003772-M01] - Analysis of KCNJ15 expression in transfected 293T cell line by KCNJ15 monoclonal antibody (M01), clone 1B2.Lane 1: KCNJ15 transfected lysate(42.6 KDa).Lane 2: Non-transfected lysate.

Western Blot: KCNJ15 Antibody (1B2) [H00003772-M01] - Analysis of KCNJ15 over-expressed 293 cell line, cotransfected with KCNJ15 Validated Chimera RNAi ( Cat # H00003772-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNJ15 monoclonal antibody (M01), clone 1B2 (Cat # H00003772-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Sandwich ELISA: KCNJ15 Antibody (1B2) [H00003772-M01] - Detection limit for recombinant GST tagged KCNJ15 is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, KD
• Clone: 1B2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KCNJ15 Antibody (1B2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: KCNJ15 (NP_002234, 290 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY
• Specificity: KCNJ15 (1B2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KCNJ15
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500RNAi Validation
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCNJ15 Antibody (1B2) - Azide and BSA Free

• inward rectifier K+ channel KIR4.2
• inwardly rectifing potassium channel Kir4.210ATP-sensitive inward rectifier potassium channel 15
• inwardly rectifying subfamily J member 15
• KCNJ14
• Kir1.3
• Kir4.2
• MGC13584
• potassium inwardly-rectifying channel, subfamily J, member 15

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNJ15
• Entrez:
  • 3772(Human)
• OMIM:
  • 602106(Human)
• Uniprot:
  • NP_002234(Human)