KCNJ10 Antibody (1C11)

Images

 
Sandwich ELISA: KCNJ10 Antibody (1C11) [H00003766-M01] - Detection limit for recombinant GST tagged KCNJ10 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
1C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KCNJ10 Antibody (1C11) Summary

Immunogen
KCNJ10 (NP_002232 276 a.a. - 379 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Specificity
KCNJ10 - potassium inwardly-rectifying channel, subfamily J, member 10
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNJ10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC usage reported in scientific literature (PMID: 27458984).
Publications
Read Publications using
H00003766-M01 in the following applications:

  • IHC
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCNJ10 Antibody (1C11)

  • ATP-dependent inwardly rectifying potassium channel Kir4.1
  • ATP-sensitive inward rectifier potassium channel 10
  • BIRK-10
  • glial ATP-dependent inwardly rectifying potassium channel KIR4.1
  • Inward rectifier K(+) channel Kir1.2
  • inward rectifier K+ channel KIR1.2
  • KCNJ13-PEN
  • KIR1.2
  • KIR4.1
  • Potassium channel, inwardly rectifying subfamily J member 10
  • potassium inwardly-rectifying channel, subfamily J, member 10
  • SESAME

Background

This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
NBP2-34127
Species: Hu
Applications: IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57515
Species: Hu
Applications: IHC-P
NBP1-83091
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-12902
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBL1-12154
Species: Hu
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KCNJ10 Antibody (H00003766-M01)(4)

Reviews for KCNJ10 Antibody (H00003766-M01) (0)

There are no reviews for KCNJ10 Antibody (H00003766-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNJ10 Antibody (H00003766-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNJ10 Products

Bioinformatics Tool for KCNJ10 Antibody (H00003766-M01)

Discover related pathways, diseases and genes to KCNJ10 Antibody (H00003766-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNJ10 Antibody (H00003766-M01)

Discover more about diseases related to KCNJ10 Antibody (H00003766-M01).
 

Pathways for KCNJ10 Antibody (H00003766-M01)

View related products by pathway.

PTMs for KCNJ10 Antibody (H00003766-M01)

Learn more about PTMs related to KCNJ10 Antibody (H00003766-M01).

Blogs on KCNJ10

There are no specific blogs for KCNJ10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNJ10 Antibody (1C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ10
Entrez
OMIM
Uniprot