KCNE1-like Antibody

Images

 
Western Blot: KCNE1-like Antibody [NBP2-83103] - Host: Rabbit. Target Name: KCNE1L. Sample Tissue: Human Ovary Tumor. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNE1-like Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human KCNE1-like. Peptide sequence: RLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNE1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNE1-like Antibody

  • AMME syndrome candidate gene 2 protein
  • AMMECR2 protein
  • AMMECR2
  • cardiac voltage-gated potassium channel accessory subunit 5
  • KCNE1-like
  • KCNE5
  • potassium voltage-gated channel subfamily E member 1-like protein
  • potassium voltage-gated channel, Isk-related family, member 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003753-M01
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, KD
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NBP1-49885
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-76945
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-32766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67561
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P, IP
NBP1-82860
Species: Hu
Applications: IHC, IHC-P
NBP2-12900
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP1-92089
Species: Hu
Applications: WB, IHC, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, KD
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74102
Species: Mu, Ha
Applications: WB

Publications for KCNE1-like Antibody (NBP2-83103) (0)

There are no publications for KCNE1-like Antibody (NBP2-83103).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNE1-like Antibody (NBP2-83103) (0)

There are no reviews for KCNE1-like Antibody (NBP2-83103). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNE1-like Antibody (NBP2-83103) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KCNE1-like Products

Bioinformatics Tool for KCNE1-like Antibody (NBP2-83103)

Discover related pathways, diseases and genes to KCNE1-like Antibody (NBP2-83103). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNE1-like Antibody (NBP2-83103)

Discover more about diseases related to KCNE1-like Antibody (NBP2-83103).
 

Pathways for KCNE1-like Antibody (NBP2-83103)

View related products by pathway.

Blogs on KCNE1-like

There are no specific blogs for KCNE1-like, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNE1-like Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE1L