KCNA7 Antibody - BSA Free

Staining of human cell line SiHa shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCNA7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNA7 Antibody - BSA Free (NBP3-24934) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein KCNA7 using the following amino acid sequence: TEGEEAGMFSHVDMQPCGPLEGKANGGLVDGEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNA7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Reactivity Notes

Mouse, Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KCNA7 Antibody - BSA Free

• HAK6
• KCNA7
• KV1.7
• potassium voltage-gated channel subfamily A member 7
• potassium voltage-gated channel, shaker-related subfamily, member 7
• voltage-dependent potassium channel Kv1.7
• voltage-gated potassium channel KCNA7
• Voltage-gated potassium channel subunit Kv1.7

Background

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. The gene is expressed preferentially in skeletal muscle, heart and kidney. It is a candidate gene for inherited cardiac disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNA7