Kv7.5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Kv7.5 Antibody [NBP1-82861] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv7.5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNQ5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Kv7.5 Protein (NBP1-82861PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv7.5 Antibody

  • KQT-like 5
  • Kv7.5
  • potassium channel protein
  • Potassium channel subunit alpha KvLQT5
  • potassium voltage-gated channel subfamily KQT member 5
  • potassium voltage-gated channel, KQT-like subfamily, member 5
  • Voltage-gated potassium channel subunit Kv7.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-74102
Species: Mu, ChHa
Applications: WB
NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP2-12899
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NLS7412
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
NBP1-83238
Species: Hu
Applications: IHC, IHC-P
NBP1-20149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00003736-B01P
Species: Hu
Applications: WB
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF3795
Species: Hu
Applications: WB, IP
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82861
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Kv7.5 Antibody (NBP1-82861) (0)

There are no publications for Kv7.5 Antibody (NBP1-82861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv7.5 Antibody (NBP1-82861) (0)

There are no reviews for Kv7.5 Antibody (NBP1-82861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Kv7.5 Antibody (NBP1-82861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv7.5 Products

Bioinformatics Tool for Kv7.5 Antibody (NBP1-82861)

Discover related pathways, diseases and genes to Kv7.5 Antibody (NBP1-82861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv7.5 Antibody (NBP1-82861)

Discover more about diseases related to Kv7.5 Antibody (NBP1-82861).
 

Pathways for Kv7.5 Antibody (NBP1-82861)

View related products by pathway.

PTMs for Kv7.5 Antibody (NBP1-82861)

Learn more about PTMs related to Kv7.5 Antibody (NBP1-82861).

Blogs on Kv7.5

There are no specific blogs for Kv7.5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv7.5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNQ5