Kv7.5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Kv7.5 Antibody [NBP1-82861] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining in human cerebral cortex and pancreas tissues using anti-KCNQ5 antibody. Corresponding KCNQ5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kv7.5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kv7.5 Antibody - BSA Free (NBP1-82861) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPL
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNQ5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Kv7.5 Protein (NBP1-82861PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kv7.5 Antibody - BSA Free

• KCNQ5
• KQT-like 5
• Kv7.5
• potassium channel protein
• Potassium channel subunit alpha KvLQT5
• potassium voltage-gated channel subfamily KQT member 5
• potassium voltage-gated channel, KQT-like subfamily, member 5
• Voltage-gated potassium channel subunit Kv7.5

Background

KCNQ5 is a gene that codes for a protein that is thought to be important in the regulation of neuronal excitability, which has 5 isoforms, with lengths of 932, 923, 942, 427, and 822 amino acids and weights of approximately 102, 101, 104, 45, and 90 kDa respectively. Current studies are being done on diseases and disorders related to this gene including pharyngitis, cerebritis, schizophrenia, and neuronitis. KCNQ5 has also been shown to have interactions with CALM1, CALM2, CALM3, DISC1, and KCNQ3 in pathways such as the synaptic transmission-ion currents, dopamine-DARPP32 feedback, potassium channels, and celecoxib pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNQ5