Kv7.5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Kv7.5 Antibody [NBP1-82861] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining in human cerebral cortex and pancreas tissues using anti-KCNQ5 antibody. Corresponding KCNQ5 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Kv7.5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPL
Specificity
Specificity of human Kv7.5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNQ5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Kv7.5 Protein (NBP1-82861PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv7.5 Antibody

  • KQT-like 5
  • Kv7.5
  • potassium channel protein
  • Potassium channel subunit alpha KvLQT5
  • potassium voltage-gated channel subfamily KQT member 5
  • potassium voltage-gated channel, KQT-like subfamily, member 5
  • Voltage-gated potassium channel subunit Kv7.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-74102
Species: Mu, Ha
Applications: WB
NBP2-12898
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr
NBP2-12899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, MiAr
H00003753-M01
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-87679
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-76939
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49885
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-20149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-80429
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
AF009
Species: Hu
Applications: WB, IHC
NBP2-12900
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-80467
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82861
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Kv7.5 Antibody (NBP1-82861) (0)

There are no publications for Kv7.5 Antibody (NBP1-82861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv7.5 Antibody (NBP1-82861) (0)

There are no reviews for Kv7.5 Antibody (NBP1-82861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Kv7.5 Antibody (NBP1-82861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Kv7.5 Products

Bioinformatics Tool for Kv7.5 Antibody (NBP1-82861)

Discover related pathways, diseases and genes to Kv7.5 Antibody (NBP1-82861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv7.5 Antibody (NBP1-82861)

Discover more about diseases related to Kv7.5 Antibody (NBP1-82861).
 

Pathways for Kv7.5 Antibody (NBP1-82861)

View related products by pathway.

PTMs for Kv7.5 Antibody (NBP1-82861)

Learn more about PTMs related to Kv7.5 Antibody (NBP1-82861).

Blogs on Kv7.5

There are no specific blogs for Kv7.5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv7.5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNQ5