![Western Blot: KCMF1 Antibody [NBP2-85133] - WB Suggested Anti-KCMF1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:500. Positive Control: 721_B cell lysateKCMF1 is supported by BioGPS gene expression data to be expressed in 721_B](http://images.novusbio.com/fullsize2/KCMF1-Antibody-Western-Blot-NBP2-85133-img0001.jpg "Western Blot: KCMF1 Antibody [NBP2-85133] - WB Suggested Anti-KCMF1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:500. Positive Control: 721_B cell lysateKCMF1 is supported by BioGPS gene expression data to be expressed in 721_B")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human KCMF1. Peptide sequence: SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KCMF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.](http://images.novusbio.com/images2/ZNF645-Antibody-Western-Blot-NBP2-21037-img0001.jpg)
![Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/ZNF645-Antibody-Immunohistochemistry-Paraffin-NBP2-21037-img0002.jpg)
![Western Blot: MUL1 Antibody (5H6.2D5) [NBP2-31361] - WB detection of partial recombinant protein MUL1 by using MUL1 antibody (clone 5H6.2D5) at a concentration of 0.01 ug/ml.](http://images.novusbio.com/images2/MUL1-Antibody-(5H6.2D5)-Western-Blot-NBP2-31361-img0001.jpg)
![Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal prostate from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). Strong cytoplasmic staining was observed in the epithelial columnar and basal cells of prostate glands.](http://images.novusbio.com/images2/MUL1-Antibody-(5H6.2D5)-Immunohistochemistry-Paraffin-NBP2-31361-img0006.jpg)
![Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal cardiac stomach from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). The cardiac glands showed distinct cytoplasmic staining, wherein, the parietal cells as well as the chief cells were found positive for MUL1.](http://images.novusbio.com/images2/MUL1-Antibody-(5H6.2D5)-Immunohistochemistry-Paraffin-NBP2-31361-img0004.jpg)
![Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.](http://images.novusbio.com/images2/TRIM50-Antibody-Immunohistochemistry-Paraffin-NBP1-81988-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: CDK4 Antibody [NBP1-31308] - MCF7 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CDK4 protein stained by CDK4 antibody diluted at 1:1000.](http://images.novusbio.com/images2/CDK4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31308-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: CDK4 Antibody [NBP1-31308] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: CDK4 protein stained by CDK4 antibody diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar = 10 um.](http://images.novusbio.com/images2/CDK4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31308-img0010.jpg)
![Western Blot: CDK4 Antibody [NBP1-31308] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK4 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/CDK4-Antibody-Western-Blot-NBP1-31308-img0019.jpg)
![Western Blot: CYP27A1 Antibody (JG40-36) [NBP2-76827] - Analysis of CYP27A1 on different tissue lysates using anti-CYP27A1 antibody at 1:500 dilution. Positive control: Lane 1: Rat heart. Lane 2: Human liver. Lane 2: Human kidney.](http://images.novusbio.com/images2/CYP27A1-Antibody-(JG40-36)-Western-Blot-NBP2-76827-img0001.jpg)
![Immunohistochemistry: CYP27A1 Antibody (JG40-36) [NBP2-76827] - Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-CYP27A1 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/CYP27A1-Antibody-(JG40-36)-Immunohistochemistry-NBP2-76827-img0004.jpg)
![Immunohistochemistry: CYP27A1 Antibody (JG40-36) [NBP2-76827] - Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti-CYP27A1 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/CYP27A1-Antibody-(JG40-36)-Immunohistochemistry-NBP2-76827-img0005.jpg)
![Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11.Lane 1: TIMM8A transfected lysate(11 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/TIMM8A-Antibody-(2F11)-Western-Blot-H00001678-M01-img0008.jpg)
![Immunohistochemistry-Paraffin: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.](http://images.novusbio.com/images2/TIMM8A-Antibody-(2F11)-Immunohistochemistry-Paraffin-H00001678-M01-img0005.jpg)
![Sandwich ELISA: TIMM8A Antibody (2F11) [H00001678-M01] - Detection limit for recombinant GST tagged TIMM8A is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/images2/TIMM8A-Antibody-(2F11)-Sandwich-ELISA-H00001678-M01-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/beta-Glucuronidase-GUSB-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87511-img0006.jpg)
![Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Analysis in human liver and skeletal muscle tissues using NBP1-87511 antibody. Corresponding GUSB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/beta-Glucuronidase-GUSB-Antibody-Immunohistochemistry-Paraffin-NBP1-87511-img0009.jpg)
![Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Staining of human liver shows strong positivity in lysosomes in hepatocytes.](http://images.novusbio.com/images2/beta-Glucuronidase-GUSB-Antibody-Immunohistochemistry-Paraffin-NBP1-87511-img0010.jpg)
![Western Blot: EWSR1 Antibody [NBP2-16389] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with EWSR1 antibody diluted at a dilution of 1:1000.](http://images.novusbio.com/images2/EWSR1-Antibody-Western-Blot-NBP2-16389-img0004.jpg)
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-16389] - Paraffin-embedded rat fore brain. EWSR1 antibody dilution: 1:500.](http://images.novusbio.com/images2/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-16389-img0005.jpg)
![Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-16389] - Paraffin-embedded mouse testis. EWSR1 antibody dilution: 1:500.](http://images.novusbio.com/images2/EWSR1-Antibody-Immunohistochemistry-Paraffin-NBP2-16389-img0006.jpg)
![Immunohistochemistry-Paraffin: MDP1 Antibody [NBP1-83431] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/images2/MDP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83431-img0006.jpg)
![Western Blot: MDP1 Antibody [NBP1-83431] - Analysis in human cell lines MCF-7 and HeLa using anti-MDP1 antibody. Corresponding MDP1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/images2/MDP1-Antibody-Western-Blot-NBP1-83431-img0007.jpg)
![Immunohistochemistry: MDP1 Antibody [NBP1-83431] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/MDP1-Antibody-Immunohistochemistry-NBP1-83431-img0008.jpg)
![Western Blot: PLAP Antibody [NBP1-84996] - Analysis using Anti-PLAA antibody NBP1-84996 (A) shows similar pattern to independent antibody NBP1-84997 (B).](http://images.novusbio.com/images2/PLAP-Antibody-Western-Blot-NBP1-84996-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: PLAP Antibody [NBP1-84996] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.](http://images.novusbio.com/images2/PLAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84996-img0008.jpg)
![Immunohistochemistry-Paraffin: PLAP Antibody [NBP1-84996] - Staining of human testis shows strong positivity in a subset of cells in seminiferus ducts.](http://images.novusbio.com/images2/PLAP-Antibody-Immunohistochemistry-Paraffin-NBP1-84996-img0006.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for KCMF1 Antibody (NBP2-85133)Discover more about diseases related to KCMF1 Antibody (NBP2-85133).
| Pathways for KCMF1 Antibody (NBP2-85133)View related products by pathway.
|
PTMs for KCMF1 Antibody (NBP2-85133)Learn more about PTMs related to KCMF1 Antibody (NBP2-85133).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KCMF1 |
![Flow Cytometry: FGFR2 Antibody (5C5) [NBP2-00932] - Analysis of Hela cells, using anti-FGFR2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images/FGFR2-Antibody-(5C5)-Flow-Cytometry-NBP2-00932-img0001.jpg)
![Flow Cytometry: FGFR2 Antibody (5C5) [NBP2-00932] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-FGFR2 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/images/FGFR2-Antibody-(5C5)-Flow-Cytometry-NBP2-00932-img0002.jpg)
![Western Blot: FGFR2 Antibody (5C5) [NBP2-00932] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY FGFR2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FGFR2.](http://images.novusbio.com/images/FGFR2-Antibody-(5C5)-Western-Blot-NBP2-00932-img0003.jpg)
![Immunohistochemistry-Paraffin: DNA Polymerase gamma Antibody [NBP1-52300] - Analysis of anti-POLG antibody with human skeletal muscle at concentration 10 ug/ml.](http://images.novusbio.com/images2/DNA-Polymerase-gamma-Antibody-Immunohistochemistry-Paraffin-NBP1-52300-img0003.jpg)
![Western Blot: DNA Polymerase gamma Antibody [NBP1-52300] - Analysis of anti-POLG antibody with (30 ug of whole cell lysate). A: 293T. 5% SDS PAGE. POLG antibody diluted at 1:5000.](http://images.novusbio.com/images2/DNA-Polymerase-gamma-Antibody-Western-Blot-NBP1-52300-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: DNA Polymerase gamma Antibody [NBP1-52300] - Analysis of anti-POLG antibody with methanol-fixed HeLa cell at 1:200 dilution.](http://images.novusbio.com/images2/DNA-Polymerase-gamma-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-52300-img0002.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
