KCMF1 Antibody


Western Blot: KCMF1 Antibody [NBP2-85133] - WB Suggested Anti-KCMF1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:500. Positive Control: 721_B cell lysateKCMF1 is supported by BioGPS gene expression data to be ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

KCMF1 Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of human KCMF1. Peptide sequence: SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for KCMF1 Antibody

  • DEBT91
  • DKFZp434L1021
  • EC 6.3.2
  • EC 6.3.2.-
  • FGF-induced in gastric cancer
  • FGF-induced ubiquitin-protein ligase in gastric cancers
  • FIGC
  • PCMFdifferentially expressed in branching tubulogenesis 91
  • potassium channel modulatory factor 1
  • Potassium channel modulatory factor
  • zinc finger, ZZ domain containing 1
  • ZZ-type zinc finger-containing protein 1
  • ZZZ1E3 ubiquitin-protein ligase KCMF1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Func, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB

Publications for KCMF1 Antibody (NBP2-85133) (0)

There are no publications for KCMF1 Antibody (NBP2-85133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCMF1 Antibody (NBP2-85133) (0)

There are no reviews for KCMF1 Antibody (NBP2-85133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCMF1 Antibody (NBP2-85133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KCMF1 Products

Bioinformatics Tool for KCMF1 Antibody (NBP2-85133)

Discover related pathways, diseases and genes to KCMF1 Antibody (NBP2-85133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCMF1 Antibody (NBP2-85133)

Discover more about diseases related to KCMF1 Antibody (NBP2-85133).

Pathways for KCMF1 Antibody (NBP2-85133)

View related products by pathway.

PTMs for KCMF1 Antibody (NBP2-85133)

Learn more about PTMs related to KCMF1 Antibody (NBP2-85133).

Blogs on KCMF1

There are no specific blogs for KCMF1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KCMF1 Antibody and receive a gift card or discount.


Gene Symbol KCMF1