KChIP2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit KChIP2 Antibody - BSA Free (NBP3-38383) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KChIP2 (NP_775284.1).
Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNIP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KChIP2 Antibody - BSA Free
Background
KChIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, RIA, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
Species: Mu, Rt
Applications: WB, ELISA
Publications for KChIP2 Antibody (NBP3-38383) (0)
There are no publications for KChIP2 Antibody (NBP3-38383).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KChIP2 Antibody (NBP3-38383) (0)
There are no reviews for KChIP2 Antibody (NBP3-38383).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KChIP2 Antibody (NBP3-38383) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KChIP2 Products
Research Areas for KChIP2 Antibody (NBP3-38383)
Find related products by research area.
|
Blogs on KChIP2