KCC1/SLC12A4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KCC1/SLC12A4 Antibody [NBP1-83067] - Staining of human cell line U-2 OS shows localization to endosomes.
Immunohistochemistry-Paraffin: KCC1/SLC12A4 Antibody [NBP1-83067] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCC1/SLC12A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC12A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCC1/SLC12A4 Protein (NBP1-83067PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCC1/SLC12A4 Antibody

  • Electroneutral potassium-chloride cotransporter 1
  • Erythroid K-Cl cotransporter 1
  • FLJ17069
  • FLJ40489
  • hKCC1
  • KCC1
  • KCC1erythroid K:Cl cotransporter
  • K-Cl cotransporter
  • potassium/chloride cotransporter 1
  • SLC12A4
  • solute carrier family 12 (potassium/chloride transporters), member 4
  • solute carrier family 12 member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8369
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-85133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB8528
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
640-A3
Species: Mu
NBP1-03340
Species: Hu
Applications: WB, IP
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31441
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-62178
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP

Publications for KCC1/SLC12A4 Antibody (NBP1-83067) (0)

There are no publications for KCC1/SLC12A4 Antibody (NBP1-83067).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCC1/SLC12A4 Antibody (NBP1-83067) (0)

There are no reviews for KCC1/SLC12A4 Antibody (NBP1-83067). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KCC1/SLC12A4 Antibody (NBP1-83067) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCC1/SLC12A4 Products

Bioinformatics Tool for KCC1/SLC12A4 Antibody (NBP1-83067)

Discover related pathways, diseases and genes to KCC1/SLC12A4 Antibody (NBP1-83067). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCC1/SLC12A4 Antibody (NBP1-83067)

Discover more about diseases related to KCC1/SLC12A4 Antibody (NBP1-83067).
 

Pathways for KCC1/SLC12A4 Antibody (NBP1-83067)

View related products by pathway.

PTMs for KCC1/SLC12A4 Antibody (NBP1-83067)

Learn more about PTMs related to KCC1/SLC12A4 Antibody (NBP1-83067).

Blogs on KCC1/SLC12A4

There are no specific blogs for KCC1/SLC12A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCC1/SLC12A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A4
Entrez