KCC1/SLC12A4 Antibody


Immunocytochemistry/ Immunofluorescence: KCC1/SLC12A4 Antibody [NBP1-83067] - Staining of human cell line U-2 OS shows localization to endosomes.
Immunohistochemistry-Paraffin: KCC1/SLC12A4 Antibody [NBP1-83067] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

KCC1/SLC12A4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL
Specificity of human KCC1/SLC12A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCC1/SLC12A4 Protein (NBP1-83067PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KCC1/SLC12A4 Antibody

  • Electroneutral potassium-chloride cotransporter 1
  • Erythroid K-Cl cotransporter 1
  • FLJ17069
  • FLJ40489
  • hKCC1
  • KCC1
  • KCC1erythroid K:Cl cotransporter
  • K-Cl cotransporter
  • potassium/chloride cotransporter 1
  • SLC12A4
  • solute carrier family 12 (potassium/chloride transporters), member 4
  • solute carrier family 12 member 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP

Publications for KCC1/SLC12A4 Antibody (NBP1-83067) (0)

There are no publications for KCC1/SLC12A4 Antibody (NBP1-83067).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCC1/SLC12A4 Antibody (NBP1-83067) (0)

There are no reviews for KCC1/SLC12A4 Antibody (NBP1-83067). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KCC1/SLC12A4 Antibody (NBP1-83067) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for KCC1/SLC12A4 Antibody (NBP1-83067)

Discover related pathways, diseases and genes to KCC1/SLC12A4 Antibody (NBP1-83067). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCC1/SLC12A4 Antibody (NBP1-83067)

Discover more about diseases related to KCC1/SLC12A4 Antibody (NBP1-83067).

Pathways for KCC1/SLC12A4 Antibody (NBP1-83067)

View related products by pathway.

PTMs for KCC1/SLC12A4 Antibody (NBP1-83067)

Learn more about PTMs related to KCC1/SLC12A4 Antibody (NBP1-83067).

Blogs on KCC1/SLC12A4

There are no specific blogs for KCC1/SLC12A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KCC1/SLC12A4 Antibody and receive a gift card or discount.


Gene Symbol SLC12A4