KCC1/SLC12A4 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL |
Predicted Species |
Rat (91%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLC12A4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%),
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for KCC1/SLC12A4 Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: IHC, WB
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Bind
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Publications for KCC1/SLC12A4 Antibody (NBP1-83067) (0)
There are no publications for KCC1/SLC12A4 Antibody (NBP1-83067).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KCC1/SLC12A4 Antibody (NBP1-83067) (0)
There are no reviews for KCC1/SLC12A4 Antibody (NBP1-83067).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KCC1/SLC12A4 Antibody (NBP1-83067) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KCC1/SLC12A4 Products
Bioinformatics Tool for KCC1/SLC12A4 Antibody (NBP1-83067)
Discover related pathways, diseases and genes to KCC1/SLC12A4 Antibody (NBP1-83067). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for KCC1/SLC12A4 Antibody (NBP1-83067)
Discover more about diseases related to KCC1/SLC12A4 Antibody (NBP1-83067).
| | Pathways for KCC1/SLC12A4 Antibody (NBP1-83067)
View related products by pathway.
|
PTMs for KCC1/SLC12A4 Antibody (NBP1-83067)
Learn more about PTMs related to KCC1/SLC12A4 Antibody (NBP1-83067).
|
Blogs on KCC1/SLC12A4