KCC1/SLC12A4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KCC1/SLC12A4 Antibody [NBP1-83067] - Staining of human cell line U-2 OS shows localization to endosomes.

Immunohistochemistry-Paraffin: KCC1/SLC12A4 Antibody [NBP1-83067] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCC1/SLC12A4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCC1/SLC12A4 Antibody - BSA Free (NBP1-83067) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KCC1/SLC12A4 Protein (NBP1-83067PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%),

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KCC1/SLC12A4 Antibody - BSA Free

• Electroneutral potassium-chloride cotransporter 1
• Erythroid K-Cl cotransporter 1
• FLJ17069
• FLJ40489
• hKCC1
• KCC1
• KCC1erythroid K:Cl cotransporter
• K-Cl cotransporter
• potassium/chloride cotransporter 1
• SLC12A4
• solute carrier family 12 (potassium/chloride transporters), member 4
• solute carrier family 12 member 4

Background

Potassium-chloride cotransporters mediate the coupled movement of potassium and chloride ions across the plasma membrane. SLC12A4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling and may contribute to cell volume homeostasis in single cells. SLC12A4 may play a role in early erythroid maturation events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC12A4