katanin-p80 Antibody - BSA Free

Western Blot: katanin-p80 Antibody [NBP3-10015] - Western blot analysis of katanin-p80 in Human MDA-MB-435s lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

katanin-p80 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit katanin-p80 Antibody - BSA Free (NBP3-10015) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human katanin-p80 (NP_005877.2). Peptide sequence RVKQNSESERRSPSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPR
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KATNB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 72 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for katanin-p80 Antibody - BSA Free

• KAT
• katanin (80 kDa)
• katanin p80 (WD repeat containing) subunit B 1
• katanin p80 (WD40-containing) subunit B 1
• Katanin p80 subunit B1
• katanin p80 WD40-containing subunit B1
• p80 katanin

Background

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help toorganize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemblemicrotubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family ofATPases. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KATNB1