KAT8 regulatory NSL3 Antibody

Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human tonsil shows weak to moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human kidney shows strong positivity in cytoplasm in cells in tubules.

Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human testis shows moderate to strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

KAT8 regulatory NSL3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMGSEPRDQDAEKKKKPR
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KANSL3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
• Application Notes: IP, ICC/IF reported in scientific literature (PMID: 26243146). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KAT8 regulatory NSL3 Protein (NBP1-83875PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KAT8 regulatory NSL3 Antibody

• FLJ10081
• FLJ23799
• hypothetical protein LOC55683
• KIAA1310
• PRTD
• Rcd1
• Serum inhibited-related protein
• SI1
• Testis development protein PRTD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KAT8 regulatory NSL3 Antibody (NBP1-83875)(3)

Publications using NBP1-83875

• Sylvain Meunier, Maria Shvedunova, Nhuong Van Nguyen et al. An epigenetic regulator emerges as microtubule minus-end binding and stabilizing factor in mitosis. Nature Communications 2015-01-01 [PMID: 26243146] (ICC/IF, IP, Human)
• Chelmicki T, Dundar F, Turley MJ et al. MOF-associated complexes ensure stem cell identity and Xist repression. eLife 2014-05-19 [PMID: 24842875]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: KANSL3