KAT8 regulatory NSL3 Antibody

Images

 
Western Blot: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Analysis in human cell line SCLC-21H.
Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human tonsil shows weak to moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human kidney shows strong positivity in cytoplasm in cells in tubules.
Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human testis shows moderate to strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KAT8 regulatory NSL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMGSEPRDQDAEKKKKPR
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KANSL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IP, ICC/IF reported in scientific literature (PMID: 26243146). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KAT8 regulatory NSL3 Protein (NBP1-83875PEP)
Publications
Read Publications using
NBP1-83875 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KAT8 regulatory NSL3 Antibody

  • FLJ10081
  • FLJ23799
  • hypothetical protein LOC55683
  • KIAA1310
  • PRTD
  • Rcd1
  • Serum inhibited-related protein
  • SI1
  • Testis development protein PRTD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

257-NT/CF
Species: Hu
Applications: BA
NB120-5663
Species: Bv, Ca, Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-92354
Species: Hu
Applications: IHC, IHC-P
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS6731
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P, IP
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-84466
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-93878
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00010445-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00029883-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-81773
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83875
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for KAT8 regulatory NSL3 Antibody (NBP1-83875)(3)

Reviews for KAT8 regulatory NSL3 Antibody (NBP1-83875) (0)

There are no reviews for KAT8 regulatory NSL3 Antibody (NBP1-83875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KAT8 regulatory NSL3 Antibody (NBP1-83875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KAT8 regulatory NSL3 Products

Bioinformatics Tool for KAT8 regulatory NSL3 Antibody (NBP1-83875)

Discover related pathways, diseases and genes to KAT8 regulatory NSL3 Antibody (NBP1-83875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for KAT8 regulatory NSL3 Antibody (NBP1-83875)

Find related products by research area.

Blogs on KAT8 regulatory NSL3

There are no specific blogs for KAT8 regulatory NSL3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAT8 regulatory NSL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KANSL3