KAT4/TBP Associated Factor 1 Recombinant Protein Antigen

Images

 
There are currently no images for KAT4/TBP Associated Factor 1 Protein (NBP1-90036PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KAT4/TBP Associated Factor 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAF1.

Source: E. coli

Amino Acid Sequence: SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90036.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KAT4/TBP Associated Factor 1 Recombinant Protein Antigen

  • 250kDa
  • BA2R
  • BA2Rdystonia 3 (with Parkinsonism)
  • CCG1
  • CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD
  • CCGS
  • Cell cycle gene 1 protein
  • cell cycle, G1 phase defect
  • complementation of cell cycle block, G1-to-S
  • DYT3/TAF1
  • EC 2.7.11
  • EC 2.7.11.1
  • KAT4
  • KAT4/TBP Associated Factor 1
  • NSCL2
  • OF
  • p250
  • TAF(II)250
  • TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF1
  • TAF2A
  • TAF2AN-TAF1
  • TAFII250
  • TAFII-250
  • TAFII250DYT3
  • TBP-associated factor 250 kDa
  • transcription factor TFIID p250 polypeptide
  • Transcription initiation factor TFIID 250 kDa subunit
  • transcription initiation factor TFIID subunit 1
  • XDP

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP3-37988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80705
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00008850-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF4196
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC,  IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
3047-CC
Species: Hu
Applications: BA
H00006879-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP1-90036PEP
Species: Hu
Applications: AC

Publications for KAT4/TBP Associated Factor 1 Protein (NBP1-90036PEP) (0)

There are no publications for KAT4/TBP Associated Factor 1 Protein (NBP1-90036PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT4/TBP Associated Factor 1 Protein (NBP1-90036PEP) (0)

There are no reviews for KAT4/TBP Associated Factor 1 Protein (NBP1-90036PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KAT4/TBP Associated Factor 1 Protein (NBP1-90036PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KAT4/TBP Associated Factor 1 Products

Research Areas for KAT4/TBP Associated Factor 1 Protein (NBP1-90036PEP)

Find related products by research area.

Blogs on KAT4/TBP Associated Factor 1

There are no specific blogs for KAT4/TBP Associated Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KAT4/TBP Associated Factor 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1