Recombinant Human KAT4/TBP Associated Factor 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KAT4/TBP Associated Factor 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1784-1893 of Human TAF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Protein/Peptide Type
Partial Recombinant Protein
Gene
TAF1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KAT4/TBP Associated Factor 1 Protein

  • 250kDa
  • BA2Rdystonia 3 (with Parkinsonism)
  • CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD
  • CCGS
  • Cell cycle gene 1 protein
  • cell cycle, G1 phase defect
  • complementation of cell cycle block, G1-to-S
  • DYT3/TAF1
  • EC 2.7.11
  • EC 2.7.11.1
  • KAT4
  • NSCL2
  • OF
  • P250
  • TAF(II)250
  • TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF2AN-TAF1
  • TAFII-250
  • TAFII250DYT3
  • TBP-associated factor 250 kDa
  • transcription factor TFIID p250 polypeptide
  • Transcription initiation factor TFIID 250 kDa subunit
  • transcription initiation factor TFIID subunit 1
  • XDP

Background

TAF1 - TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00006879-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA

Publications for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01) (0)

There are no publications for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01) (0)

There are no reviews for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KAT4/TBP Associated Factor 1 Products

Bioinformatics Tool for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01)

Discover related pathways, diseases and genes to KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01)

Discover more about diseases related to KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01).
 

Pathways for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01)

View related products by pathway.

PTMs for KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01)

Learn more about PTMs related to KAT4/TBP Associated Factor 1 Partial Recombinant Protein (H00006872-Q01).

Blogs on KAT4/TBP Associated Factor 1

There are no specific blogs for KAT4/TBP Associated Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KAT4/TBP Associated Factor 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1