Recombinant Human KAT4/TBP Associated Factor 1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human KAT4/TBP Associated Factor 1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1784-1893 of Human KAT4/TBP Associated Factor 1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: TAF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 37.84 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KAT4/TBP Associated Factor 1 GST (N-Term) Protein

• 250kDa
• BA2R
• BA2Rdystonia 3 (with Parkinsonism)
• CCG1
• CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD
• CCGS
• Cell cycle gene 1 protein
• cell cycle, G1 phase defect
• complementation of cell cycle block, G1-to-S
• DYT3/TAF1
• EC 2.7.11
• EC 2.7.11.1
• KAT4
• KAT4/TBP Associated Factor 1
• NSCL2
• OF
• p250
• TAF(II)250
• TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TAF1
• TAF2A
• TAF2AN-TAF1
• TAFII250
• TAFII-250
• TAFII250DYT3
• TBP-associated factor 250 kDa
• transcription factor TFIID p250 polypeptide
• Transcription initiation factor TFIID 250 kDa subunit
• transcription initiation factor TFIID subunit 1
• XDP

Background

TAF1 - TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF1