Kallikrein 7 Antibody - BSA Free

Western Blot: Kallikrein 7 Antibody [NBP1-87208] - Analysis in control (vector only transfected HEK293T lysate) and KLK7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Kallikrein 7 Antibody [NBP1-87208] - Staining of human cell line HaCaT shows localization to plasma membrane. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kallikrein 7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLK7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Reactivity Notes

Expected cross-reactivity based on sequence identity: Rat (81%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kallikrein 7 Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.117
• hK7
• hSCCE
• kallikrein 7 (chymotryptic, stratum corneum)
• Kallikrein 7
• kallikrein-related peptidase 7
• KLK7
• protease, serine, 6
• PRSS6
• SCCEkallikrein-7
• Serine protease 6
• signal protein
• Stratum corneum chymotryptic enzyme

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLK7