We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Kallikrein 4/Prostase/EMSP1 Recombinant Protein Antigen

Images

 
There are currently no images for Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kallikrein 4/Prostase/EMSP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLK4.

Source: E. coli

Amino Acid Sequence: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLK4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14171.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kallikrein 4/Prostase/EMSP1 Recombinant Protein Antigen

  • AI2A1
  • ARM1
  • EC 3.4.21
  • EC 3.4.21.-
  • EMSP
  • EMSP1
  • EMSP1MGC116827
  • Enamel matrix serine proteinase 1
  • kallikrein 4 (prostase, enamel matrix, prostate)
  • Kallikrein 4
  • kallikrein-4
  • Kallikrein-like protein 1
  • kallikrein-related peptidase 4
  • KLK4
  • KLK-L1MGC116828
  • Prostase
  • PRSS17enamel matrix serine protease 1
  • PSTSandrogen-regulated message 1
  • Serine protease 17

Background

Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. The novel KLK gene, KLK-L4, is expressed in a variety of tissues including prostate, salivary gland, breast, and testis. Its expression is regulated by steroid hormones in breast cancer cell lines may be involved in the pathogenesis and/or progression of breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1396
Species: Hu
Applications: WB
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
DKK300
Species: Hu
Applications: ELISA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-94203
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89993
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2498
Species: Mu
Applications: IP, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
MAB2337
Species: Hu
Applications: IP, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-06046
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-94203
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1142
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF2008
Species: Hu
Applications: IHC, IP, WB
NBP3-47082
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-14171PEP
Species: Hu
Applications: AC

Publications for Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP) (0)

There are no publications for Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP) (0)

There are no reviews for Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kallikrein 4/Prostase/EMSP1 Products

Research Areas for Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP)

Find related products by research area.

Blogs on Kallikrein 4/Prostase/EMSP1

There are no specific blogs for Kallikrein 4/Prostase/EMSP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kallikrein 4/Prostase/EMSP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK4