Kallikrein 1 Antibody (3D1)

Images

 
There are currently no images for Kallikrein 1 Antibody (H00003816-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kallikrein 1 Antibody (3D1) Summary

Immunogen
KLK1 (AAH05313 168 a.a. - 262 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KLK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kallikrein 1 Antibody (3D1)

  • EC 3.4.21
  • EC 3.4.21.35
  • glandular kallikrein 1
  • hK1
  • Kallikrein 1
  • kallikrein 1, renal/pancreas/salivary
  • kallikrein serine protease 1
  • kallikrein-1
  • Kidney/pancreas/salivary gland kallikrein
  • KLK1
  • Klk6
  • KLKR
  • Tissue kallikrein

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. This protein is functionally conserved in its capacity to release the vasoactive peptide, Lys-bradykinin, from low molecular weight kininogen. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1396
Species: Hu
Applications: WB
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
MAB1569
Species: Hu
Applications: WB, IHC, IP
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF1669
Species: Hu
Applications: WB, IHC, IP, Neut
MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
AF2007
Species: Hu
Applications: WB
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP2-14986
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003816-M02
Species: Hu
Applications: WB, ELISA

Publications for Kallikrein 1 Antibody (H00003816-M02) (0)

There are no publications for Kallikrein 1 Antibody (H00003816-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 1 Antibody (H00003816-M02) (0)

There are no reviews for Kallikrein 1 Antibody (H00003816-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 1 Antibody (H00003816-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 1 Products

Bioinformatics Tool for Kallikrein 1 Antibody (H00003816-M02)

Discover related pathways, diseases and genes to Kallikrein 1 Antibody (H00003816-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 1 Antibody (H00003816-M02)

Discover more about diseases related to Kallikrein 1 Antibody (H00003816-M02).
 

Pathways for Kallikrein 1 Antibody (H00003816-M02)

View related products by pathway.

PTMs for Kallikrein 1 Antibody (H00003816-M02)

Learn more about PTMs related to Kallikrein 1 Antibody (H00003816-M02).
 

Research Areas for Kallikrein 1 Antibody (H00003816-M02)

Find related products by research area.

Blogs on Kallikrein 1

There are no specific blogs for Kallikrein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 1 Antibody (3D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK1
Entrez
Uniprot