Kaiso Antibody (10O4V2)

Western Blot: Kaiso Antibody (10O4V2) [NBP3-16272] - Western blot analysis of extracts of various cell lines, using Kaiso Rabbit mAb (NBP3-16272) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: Kaiso Antibody (10O4V2) [NBP3-16272] - Immunofluorescence analysis of HeLa cells using Kaiso Rabbit mAb (NBP3-16272) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation: Kaiso Antibody (10O4V2) [NBP3-16272] - Immunoprecipitation analysis of 300ug extracts of A-549 cells using 3ug Kaiso antibody (NBP3-16272). Western blot was performed from the immunoprecipitate using Kaiso antibody (NBP3-16272) at a dilition of 1:1000.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IP
• Clone: 10O4V2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Kaiso Antibody (10O4V2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 573-672 of human Kaiso (Q86T24). HSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ZBTB33
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kaiso Antibody (10O4V2)

• KAISOkaiso transcription factor
• transcriptional regulator Kaiso
• WUGSC:H_DJ525N14.1
• zinc finger and BTB domain containing 33
• Zinc finger and BTB domain-containing protein 33
• ZNF348kaiso
• ZNF-kaiso

Background

KAISO is a transcriptional regulator that binds, via its zinc fingers, to DNA sequences containing methylated CGCG or to the consensus KAISO-binding site (KBS) TCCTGCNA (Filion et al., 2006 (PubMed 16354688)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZBTB33