JWA Antibody - Azide and BSA Free

Western Blot: JWA Antibody [NBP3-03886] - Analysis of extracts of mouse thymus, using JWA antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit .

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

JWA Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit JWA Antibody - Azide and BSA Free (NBP3-03886) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human JWA (NP_006398.1). TFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARL6IP5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for JWA Antibody - Azide and BSA Free

• ADP-ribosylation factor-like protein 6-interacting protein 5
• ADP-ribosylation-like factor 6 interacting protein 5
• Aip-5
• ARL-6-interacting protein 5
• Cytoskeleton-related vitamin A-responsive protein
• Dermal papilla-derived protein 11
• DERP11addicsin
• Glutamate transporter EAAC1-interacting protein
• glutamate transporter EEAC1-associated protein
• GTRAP3-18aip-5
• hp22
• HSPC127
• JM5
• jmx
• JWAcytoskeleton related vitamin A responsive protein
• PRA1 domain family 3
• PRA1 family protein 3
• PRA2
• PRAF3dermal papilla derived protein 11
• Prenylated Rab acceptor protein 2
• Protein JWa
• putative MAPK activating protein PM27
• Putative MAPK-activating protein PM27

Background

The function of this protein is unknown but a similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ARL6IP5