Recombinant Human Jumonji/JARID2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Jumonji/JARID2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1130 - 1229 of Human JARID2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP

Protein/Peptide Type
Partial Recombinant Protein
Gene
JARID2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Jumonji/JARID2 Protein

  • JARID2
  • JMJ
  • JMJjumonji-like protein
  • jumonji (mouse) homolog
  • jumonji homolog
  • Jumonji
  • jumonji, AT rich interactive domain 2
  • Jumonji/ARID domain-containing protein 2
  • protein Jumonji

Background

JARID2 - Jumonji, AT rich interactive domain 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF6846
Species: Hu
Applications: IHC
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB110-40499
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-06640
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
H00084838-M08
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003720-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01) (0)

There are no publications for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01) (0)

There are no reviews for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Jumonji/JARID2 Products

Bioinformatics Tool for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01)

Discover related pathways, diseases and genes to Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01)

Discover more about diseases related to Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01).
 

Pathways for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01)

View related products by pathway.

PTMs for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01)

Learn more about PTMs related to Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01).
 

Research Areas for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01)

Find related products by research area.

Blogs on Jumonji/JARID2

There are no specific blogs for Jumonji/JARID2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Jumonji/JARID2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol JARID2
Entrez