JPH1 Antibody - BSA Free

Western Blot: JPH1 Antibody [NBP3-35854] - Western blot analysis of lysates from Mouse skeletal muscle, using JPH1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

JPH1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit JPH1 Antibody - BSA Free (NBP3-35854) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 410-640 of human JPH1 (NP_065698.1).
  
  Sequence:
  RELSPDFYQPGPDYVKQRFQEGVDAKENPEEKVPEKPPTPKESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JPH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 72 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for JPH1 Antibody - BSA Free

• DKFZp762L0313
• JP-1junctophilin type1
• JP1junctophilin-1
• junctophilin 1
• Junctophilin type 1
• mitsugumin72

Background

JPH1 is a gene which codes for a protein that contributes to the formation of skeletal muscles, as well as a membrane complex which links the plasma membrane to the endoplasmic/sarcoplasmic reticulum as well as serves as a structural base for communication between the cell surface and intracellular calcium channels and is 661 amino acids long, weighing approximately 72 kDa. Current studies are being done on diseases and disorders related to this gene such as pneumonia, malaria, and neuronitis. JPH1 has also been shown to have interactions with SMAD3, TP63, TP73, JPH2, and JPH3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JPH1