JPH1 Antibody

Images

 
Western Blot: JPH1 Antibody [NBP1-83075] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: JPH1 Antibody [NBP1-83075] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: JPH1 Antibody [NBP1-83075] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

JPH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
JPH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
JPH1 Protein (NBP1-83075PEP)
Publications
Read Publication using NBP1-83075.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for JPH1 Antibody

  • DKFZp762L0313
  • JP-1junctophilin type1
  • JP1junctophilin-1
  • junctophilin 1
  • Junctophilin type 1
  • mitsugumin72

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-87417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP2-01679
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69229
Species: Hu
Applications: WB
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-04611
Species: Hu
H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB300-542
Species: Hu, Mu, Rt, GP, Rb
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-83075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for JPH1 Antibody (NBP1-83075)(1)

Reviews for JPH1 Antibody (NBP1-83075) (0)

There are no reviews for JPH1 Antibody (NBP1-83075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for JPH1 Antibody (NBP1-83075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional JPH1 Products

Bioinformatics Tool for JPH1 Antibody (NBP1-83075)

Discover related pathways, diseases and genes to JPH1 Antibody (NBP1-83075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JPH1 Antibody (NBP1-83075)

Discover more about diseases related to JPH1 Antibody (NBP1-83075).

Blogs on JPH1

There are no specific blogs for JPH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JPH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol JPH1