JPH1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: JPH1 Antibody [NBP1-83075] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.

Immunohistochemistry-Paraffin: JPH1 Antibody [NBP1-83075] - Staining in human skeletal muscle and prostate tissues using anti-JPH1 antibody. Corresponding JPH1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: JPH1 Antibody [NBP1-83075] - Staining of human prostate shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

JPH1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JPH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  JPH1 Protein (NBP1-83075PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for JPH1 Antibody - BSA Free

• DKFZp762L0313
• JP-1junctophilin type1
• JP1junctophilin-1
• junctophilin 1
• Junctophilin type 1
• mitsugumin72

Background

JPH1 is a gene which codes for a protein that contributes to the formation of skeletal muscles, as well as a membrane complex which links the plasma membrane to the endoplasmic/sarcoplasmic reticulum as well as serves as a structural base for communication between the cell surface and intracellular calcium channels and is 661 amino acids long, weighing approximately 72 kDa. Current studies are being done on diseases and disorders related to this gene such as pneumonia, malaria, and neuronitis. JPH1 has also been shown to have interactions with SMAD3, TP63, TP73, JPH2, and JPH3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for JPH1 Antibody (NBP1-83075)(1)

Publication using NBP1-83075

• Boncompagni S, Thomas M, Lopez JR et al. Triadin/Junctin double null mouse reveals a differential role for Triadin and Junctin in anchoring CASQ to the jSR and regulating Ca(2+) homeostasis. PLoS One 2012-01-01 [PMID: 22768324]

Bioinformatics

• Gene Symbol: JPH1