JMJD6/PSR Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

JMJD6/PSR Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JMJD6/PSR
  
  

  Source: E.coli

  Amino Acid Sequence: MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: JMJD6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24927It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JMJD6/PSR Recombinant Protein Antigen

• bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
• EC 1.14.11
• EC 1.14.11.-
• Histone arginine demethylase JMJD6
• JmjC domain-containing protein 6
• JMJD6
• jumonji domain containing 6
• Jumonji domain-containing protein 6
• KIAA0585PSR
• Lysyl-hydroxylase JMJD6
• Peptide-lysine 5-dioxygenase JMJD6
• Phosphatidylserine receptorPTDSR
• Protein PTDSR
• PSR
• PTDSR
• PTDSR1

Background

JMJD6 encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JMJD6