JMJD1B Antibody [mFluor Violet 610 SE]

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 610 SE

JMJD1B Antibody [mFluor Violet 610 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-600 of human JMJD1B (NP_057688.2).
  
  Sequence:
  GAENKEAGKTLEQVGQGIVASAAVVTTASSTPNTVRISDTGLAAGTVPEKQKGSRSQASGENSRNSILASSGFGAPLPSSSQPLTFGSGRSQSNGVLATENKPLGFSFGCSSAQEAQKDTDLSKNLFFQCMSQTLPTSNYFTTVSESLADDSSSRDSFKQSLESLSSGLCKGRSVLGTDTKPGSKAGSSVDRKVPAESMPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KDM3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for JMJD1B Antibody [mFluor Violet 610 SE]

• C5orf7
• EC 1.14.11
• EC 1.14.11.-
• EC 1.14.11.65
• JHDM2B
• JmjC domain-containing histone demethylation protein 2B
• JMJD1B
• jumonji domain containing 1B
• Jumonji domain-containing protein 1B
• KDM3B
• KIAA1082
• KIAA1082chromosome 5 open reading frame 7
• lysine (K)-specific demethylase 3B
• lysine-specific demethylase 3B
• NET22,5qNCA
• Nuclear protein 5qNCA

Background

JMJD1B is a member of the jumonji (jmj) domain containing gene family of histone demethylases that plays a role in chromatin regulation and influences transcriptional activation and suppression. Some recently characterized members of the jmj family include JARID1A/RBP2, JARID1C, JMJD1A, JMJD1B, JMJD1C, JMJD2A, JMJD2C and JMJD2D. JMJD1B was identified as the 5qNCA gene that lies within a locus on chromosome 5 that is frequently deleted in myeloid leukemias and myelodysplasias. JMJD1B has been demonstrated to have growth suppressive activity and is implicated as a tumor suppressor gene. Alternate names for JMJD1B include JmjC domain-containing histone demethylation protein 2B, jumonji domain-containing protein 1B, nuclear protein 5qNCA, c5orf7, JHDM2B, and KIAA1082.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KDM3B