JMJD1B Antibody - Azide and BSA Free Summary
| Immunogen |
JMJD1B (AAH01202.1, 1 a.a. - 759 a.a.) full-length human protein. MSEKEAMMMVEPHQKVAWKRAVRGVREMCDVCETTLFNIHWVCRKCGFGVCLDCYRLRKSRPRSETEEMGDEEVFSWLKCAKGQSHEPENLMPTQIIPGTALYNIGDMVHAARGKWGIKANCPCISRQNKSVLRPAVTNGMSQLPSINPSASSGNETTFSGGGGPAPVTTPEPDHVPKADSTDIRSEEPLKTDSSASNSNSELKAIRPPCPDTAPPSSALHWLADLATQKAKEETKEAGSLRSVLNKESHSPFGLDSFNSTAKVSPLTPKLFNSLLLGPTASNNKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVFSTSSAGVKSKASLPNFLDHIIASVVENKKTSDASKRACNLTDTQKEVKEMVMGLNVLDPHTSHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQPVLVSGVHKKLKSELWKPEAFSQEFGDQDVDLVNCRNCAIISDVKVRDFWDGFEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNIIYHAVKDAVGTLKAHESKLARS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
KDM3B |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Immunogen affinity purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for JMJD1B Antibody - Azide and BSA Free
Background
JMJD1B is a member of the jumonji (jmj) domain containing gene family of histone demethylases that plays a role in chromatin regulation and influences transcriptional activation and suppression. Some recently characterized members of the jmj family include JARID1A/RBP2, JARID1C, JMJD1A, JMJD1B, JMJD1C, JMJD2A, JMJD2C and JMJD2D. JMJD1B was identified as the 5qNCA gene that lies within a locus on chromosome 5 that is frequently deleted in myeloid leukemias and myelodysplasias. JMJD1B has been demonstrated to have growth suppressive activity and is implicated as a tumor suppressor gene. Alternate names for JMJD1B include JmjC domain-containing histone demethylation protein 2B, jumonji domain-containing protein 1B, nuclear protein 5qNCA, c5orf7, JHDM2B, and KIAA1082.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: IP, KD, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ec
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Publications for JMJD1B Antibody (H00051780-B01P-50ug) (0)
There are no publications for JMJD1B Antibody (H00051780-B01P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for JMJD1B Antibody (H00051780-B01P-50ug) (0)
There are no reviews for JMJD1B Antibody (H00051780-B01P-50ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for JMJD1B Antibody (H00051780-B01P-50ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional JMJD1B Products
Array H00051780-B01P-50ug
Research Areas for JMJD1B Antibody (H00051780-B01P-50ug)
Find related products by research area.
|
Blogs on JMJD1B