JIP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: JIP1 Antibody [NBP2-56324] - Staining of human cell line SH-SY5Y shows localization to plasma membrane.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

JIP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAY
Specificity
Specificity of human JIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPK8IP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for JIP1 Antibody

  • IB1
  • JIP1
  • MAPK8IP1
  • PRKM8IP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-31411
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67764
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67372
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
AF1205
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-79794
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7906
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-76307
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-81272
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4559
Species: Hu
Applications: WB

Publications for JIP1 Antibody (NBP2-56324) (0)

There are no publications for JIP1 Antibody (NBP2-56324).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JIP1 Antibody (NBP2-56324) (0)

There are no reviews for JIP1 Antibody (NBP2-56324). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for JIP1 Antibody (NBP2-56324) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional JIP1 Products

Bioinformatics Tool for JIP1 Antibody (NBP2-56324)

Discover related pathways, diseases and genes to JIP1 Antibody (NBP2-56324). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JIP1 Antibody (NBP2-56324)

Discover more about diseases related to JIP1 Antibody (NBP2-56324).
 

Pathways for JIP1 Antibody (NBP2-56324)

View related products by pathway.

PTMs for JIP1 Antibody (NBP2-56324)

Learn more about PTMs related to JIP1 Antibody (NBP2-56324).

Blogs on JIP1

There are no specific blogs for JIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK8IP1