Jagged 1 Antibody (1E12.)

Images

 
Western Blot: Jagged 1 Antibody (1E12.) [H00000182-M01A] - Western Blot detection against Immunogen (35.64 KDa).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
1E12.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Jagged 1 Antibody (1E12.) Summary

Immunogen
JAG1 (NP_000205, 531 a.a. - 620 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG
Specificity
JAG1 (1E12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
JAG1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using
H00000182-M01A in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28848392).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Jagged 1 Antibody (1E12.)

  • AGS
  • AHDMGC104644
  • Alagille syndrome
  • AWS
  • CD339 antigen
  • CD339
  • HJ1
  • JAG1
  • Jagged 1
  • Jagged1
  • JAGL1
  • protein jagged-1

Background

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
H00000182-M01A
Species: Hu, Mu
Applications: WB, ELISA

Publications for Jagged 1 Antibody (H00000182-M01A)(3)

Reviews for Jagged 1 Antibody (H00000182-M01A) (0)

There are no reviews for Jagged 1 Antibody (H00000182-M01A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Jagged 1 Antibody (H00000182-M01A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Jagged 1 Products

Bioinformatics Tool for Jagged 1 Antibody (H00000182-M01A)

Discover related pathways, diseases and genes to Jagged 1 Antibody (H00000182-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Jagged 1 Antibody (H00000182-M01A)

Discover more about diseases related to Jagged 1 Antibody (H00000182-M01A).
 

Pathways for Jagged 1 Antibody (H00000182-M01A)

View related products by pathway.

PTMs for Jagged 1 Antibody (H00000182-M01A)

Learn more about PTMs related to Jagged 1 Antibody (H00000182-M01A).
 

Research Areas for Jagged 1 Antibody (H00000182-M01A)

Find related products by research area.

Blogs on Jagged 1

There are no specific blogs for Jagged 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Jagged 1 Antibody (1E12.) and receive a gift card or discount.

Bioinformatics

Gene Symbol JAG1
Entrez
OMIM
Uniprot