ITPR2 Antibody


Immunocytochemistry/ Immunofluorescence: ITPR2 Antibody [NBP2-56474] - Staining of human cell line U-2 OS shows localization to nucleus & endoplasmic reticulum.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

ITPR2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLT
Specificity of human ITPR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ITPR2 Antibody

  • inositol 14,5-triphosphate receptor, type 2
  • inositol 14,5-trisphosphate receptor type 2
  • insP3R2
  • IP3 receptor isoform 2
  • IP3 receptor
  • IP3R 2
  • IP3R2
  • Type 2 inositol 14,5-trisphosphate receptor
  • Type 2 InsP3 receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, IF
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu, Rt, Po
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ITPR2 Antibody (NBP2-56474) (0)

There are no publications for ITPR2 Antibody (NBP2-56474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITPR2 Antibody (NBP2-56474) (0)

There are no reviews for ITPR2 Antibody (NBP2-56474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ITPR2 Antibody (NBP2-56474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ITPR2 Products

Array NBP2-56474

Bioinformatics Tool for ITPR2 Antibody (NBP2-56474)

Discover related pathways, diseases and genes to ITPR2 Antibody (NBP2-56474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITPR2 Antibody (NBP2-56474)

Discover more about diseases related to ITPR2 Antibody (NBP2-56474).

Pathways for ITPR2 Antibody (NBP2-56474)

View related products by pathway.

PTMs for ITPR2 Antibody (NBP2-56474)

Learn more about PTMs related to ITPR2 Antibody (NBP2-56474).

Research Areas for ITPR2 Antibody (NBP2-56474)

Find related products by research area.

Blogs on ITPR2

There are no specific blogs for ITPR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ITPR2 Antibody and receive a gift card or discount.


Gene Symbol ITPR2