ITPR2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ITPR2 Antibody [NBP2-49294] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: ITPR2 Antibody [NBP2-49294] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ITPR2 Antibody [NBP2-49294] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ITPR2 Antibody [NBP2-49294] - Staining of human liver shows moderate cytoplasmic and membranous positivity in hepatocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ITPR2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ITPR2 Antibody - BSA Free (NBP2-49294) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITPR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ITPR2 Recombinant Protein Antigen (NBP2-49294PEP)

Reactivity Notes

Mouse (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ITPR2 Antibody - BSA Free

• inositol 14,5-triphosphate receptor, type 2
• inositol 14,5-trisphosphate receptor type 2
• InsP3R2
• IP3 receptor isoform 2
• IP3 receptor
• IP3R 2
• IP3R2
• ITPR2
• Type 2 inositol 14,5-trisphosphate receptor
• Type 2 InsP3 receptor

Background

Inositol 1,4,5-triphosphate (IP3) receptors are a form of ligand-gated ion channels that are activated by cytosolic Ca2+ and IP3. They are localized to intracellular membranes, such as the endoplasmic reticulum, and mediate the mobilization of intracellular Ca2+ stores. IP3 receptors play an important role in intracellular Ca2+ signaling in a variety of cell types. There are three IP3 receptor subtypes; IP3R1, IP3R2 and IP3R3, which exist as homo- and heterotetramers. All subtypes are closely associated with calmodulin and FK506-binding protein and are modulated through phosphorylation by PKA, PKC, PKG and CaMKII.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITPR2