CHML Antibody

Images

 
Western Blot: CHML Antibody [NBP1-87142] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CHML Antibody [NBP1-87142] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CHML Antibody [NBP1-87142] - Staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHML Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHML
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHML Protein (NBP1-87142PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHML Antibody

  • Choroideraemia-like protein
  • choroideremia-like (Rab escort protein 2)
  • FLJ10071
  • Rab escort protein 2
  • rab proteins geranylgeranyltransferase component A 2
  • REP-2
  • REP-2, Rab escort protein 2
  • REP2FLJ13361

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-16391
Species: Hu, Mu
Applications: WB, ICC/IF
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88099
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB120-13592
Species: Hu
Applications: WB
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP2-19629
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-87142
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHML Antibody (NBP1-87142) (0)

There are no publications for CHML Antibody (NBP1-87142).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHML Antibody (NBP1-87142) (0)

There are no reviews for CHML Antibody (NBP1-87142). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHML Antibody (NBP1-87142) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHML Products

Bioinformatics Tool for CHML Antibody (NBP1-87142)

Discover related pathways, diseases and genes to CHML Antibody (NBP1-87142). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHML Antibody (NBP1-87142)

Discover more about diseases related to CHML Antibody (NBP1-87142).
 

Pathways for CHML Antibody (NBP1-87142)

View related products by pathway.

PTMs for CHML Antibody (NBP1-87142)

Learn more about PTMs related to CHML Antibody (NBP1-87142).

Blogs on CHML

There are no specific blogs for CHML, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHML Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHML