ITIH2 Antibody - BSA Free

Western Blot: ITIH2 Antibody [NBP2-83087] - Host: Rabbit. Target Name: ITIH2. Sample Tissue: Human 786-0 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ITIH2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ITIH2. Peptide sequence: NVDFLGIYIPPTNKFSPKAHGLIGQFMQEPKIHIFNERPGKDPEKPEASM The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITIH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ITIH2 Antibody - BSA Free

• H2P
• IGHEP2
• Inter-Alpha (Globulin) Inhibitor H2
• inter-alpha (globulin) inhibitor, H2 polypeptide
• Inter-alpha-inhibitor heavy chain 2
• Inter-alpha-trypsin inhibitor complex component II
• inter-alpha-trypsin inhibitor heavy chain H2
• Intin2
• ITI Heavy Chain H2
• ITIH2
• ITI-H2
• ITI-HC2
• Serum-derived hyaluronan-associated protein
• SHAP

Background

The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. The ITI family contains multiple proteins made up of a light chain (see MIM 176870) and a variable number of heavy chains (Salier et al., 1987 (PubMed 2446322); Himmelfarb et al., 2004 (PubMed 14744536)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITIH2