Isopeptidase T/USP5 Antibody (4G4)

Images

 
There are currently no images for Isopeptidase T/USP5 Antibody (H00008078-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Isopeptidase T/USP5 Antibody (4G4) Summary

Immunogen
USP5 (NP_003472, 71 a.a. - 180 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Isopeptidase T/USP5 Antibody (4G4)

  • Deubiquitinating enzyme 5
  • EC 3.1.2.15
  • EC 3.4.19.12
  • Isopeptidase T
  • IsoT
  • ISOTubiquitin carboxyl-terminal hydrolase 5
  • ubiquitin isopeptidase T
  • ubiquitin specific peptidase 5 (isopeptidase T)
  • ubiquitin specific protease 5 (isopeptidase T)
  • ubiquitin thioesterase 5
  • Ubiquitin thiolesterase 5
  • ubiquitin-specific protease-5 (ubiquitin isopeptidase T)
  • Ubiquitin-specific-processing protease 5
  • USP5

Background

Modification of target proteins by ubiquitin participates in a wide array of biological functions. Proteins destined for degradation or processing via the 26 S proteasome are coupled to multiple copies of ubiquitin. However, attachment of ubiquitin or ubiquitin-related molecules may also result in changes in subcellular distribution or modification of protein activity. An additional level of ubiquitin regulation, deubiquitination, is catalyzed by proteases called deubiquitinating enzymes, which fall into four distinct families. Ubiquitin C-terminal hydrolases, ubiquitin-specific processing proteases (USPs),1 OTU-domain ubiquitin-aldehyde-binding proteins, and Jab1/Pad1/MPN-domain-containing metallo-enzymes. Among these four families, USPs represent the most widespread and represented deubiquitinating enzymes across evolution. USPs tend to release ubiquitin from a conjugated protein. They display similar catalytic domains containing conserved Cys and His boxes but divergent N-terminal and occasionally C-terminal extensions, which are thought to function in substrate recognition, subcellular localization, and protein-protein interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF7760
Species: Hu, Mu, Rt
Applications: WB
H00009960-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NB100-513
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-48047
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-652
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-45514
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF

Publications for Isopeptidase T/USP5 Antibody (H00008078-M02) (0)

There are no publications for Isopeptidase T/USP5 Antibody (H00008078-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Isopeptidase T/USP5 Antibody (H00008078-M02) (0)

There are no reviews for Isopeptidase T/USP5 Antibody (H00008078-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Isopeptidase T/USP5 Antibody (H00008078-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Isopeptidase T/USP5 Products

Bioinformatics Tool for Isopeptidase T/USP5 Antibody (H00008078-M02)

Discover related pathways, diseases and genes to Isopeptidase T/USP5 Antibody (H00008078-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Isopeptidase T/USP5 Antibody (H00008078-M02)

Discover more about diseases related to Isopeptidase T/USP5 Antibody (H00008078-M02).
 

Pathways for Isopeptidase T/USP5 Antibody (H00008078-M02)

View related products by pathway.

PTMs for Isopeptidase T/USP5 Antibody (H00008078-M02)

Learn more about PTMs related to Isopeptidase T/USP5 Antibody (H00008078-M02).

Blogs on Isopeptidase T/USP5

There are no specific blogs for Isopeptidase T/USP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Isopeptidase T/USP5 Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol USP5
Entrez
Uniprot