GNG2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GNG2 Antibody [NBP1-86156] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & vesicles.
Immunohistochemistry-Paraffin: GNG2 Antibody [NBP1-86156] - Staining of human colon shows distinct positivity in endothelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GNG2 Protein (NBP1-86156PEP)
Publications
Read Publications using NBP1-86156.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24734007)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GNG2 Antibody

  • G gamma-I
  • guanine nucleotide binding protein (G protein), gamma 2
  • guanine nucleotide binding protein gamma 2
  • guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-83390
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
H00005998-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
640-A3
Species: Mu
AF2364
Species: Hu
Applications: WB, IHC
H00005229-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
H00051765-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for GNG2 Antibody (NBP1-86156)(2)

Reviews for GNG2 Antibody (NBP1-86156) (0)

There are no reviews for GNG2 Antibody (NBP1-86156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GNG2 Antibody (NBP1-86156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNG2 Products

Bioinformatics Tool for GNG2 Antibody (NBP1-86156)

Discover related pathways, diseases and genes to GNG2 Antibody (NBP1-86156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNG2 Antibody (NBP1-86156)

Discover more about diseases related to GNG2 Antibody (NBP1-86156).
 

Pathways for GNG2 Antibody (NBP1-86156)

View related products by pathway.

PTMs for GNG2 Antibody (NBP1-86156)

Learn more about PTMs related to GNG2 Antibody (NBP1-86156).
 

Research Areas for GNG2 Antibody (NBP1-86156)

Find related products by research area.

Blogs on GNG2

There are no specific blogs for GNG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNG2