GNG2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GNG2 Antibody [NBP1-86156] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GNG2 Antibody [NBP1-86156] - Staining of human colon shows distinct positivity in endothelial cells.

Analysis in control (vector only transfected HEK293T lysate) and GNG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GNG2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GNG2 Antibody - BSA Free (NBP1-86156) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GNG2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GNG2 Protein (NBP1-86156PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GNG2 Antibody - BSA Free

• G gamma-I
• guanine nucleotide binding protein (G protein), gamma 2
• guanine nucleotide binding protein gamma 2
• guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

Background

Heterotrimeric G proteins play vital roles in cellular responses to external signals. The specificity of a Gprotein-receptor interaction is primarily mediated by the gamma subunit.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GNG2 Antibody (NBP1-86156)(2)

Publications using NBP1-86156

• Cozzi B, Roncon G, Granato A et al. The claustrum of the bottlenose dolphin Tursiops truncatus (Montagu 1821). Front Syst Neurosci 2014-01-01 [PMID: 24734007]
• Pirone A, Cozzi B, Edelstein L et al. Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum. PLoS One 2012-01-01 [PMID: 22957104]

Bioinformatics

• Gene Symbol: GNG2