ISCU Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ISCU Antibody [NBP2-38420] - Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.

Immunohistochemistry: ISCU Antibody [NBP2-38420] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ISCU Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ISCU Antibody - BSA Free (NBP2-38420) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPK
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ISCU
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ISCU Protein (NBP2-38420PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ISCU Antibody - BSA Free

• 2310020H20Rik
• HML
• hnifU
• iron-sulfur cluster assembly enzyme ISCU, mitochondrial
• iron-sulfur cluster scaffold homolog (E. coli)
• IscU iron-sulfur cluster scaffold homolog (E. coli)
• IscU iron-sulfur cluster scaffold homolog
• IscU
• ISU2
• MGC74517
• NIFU
• NifU-like N-terminal domain containing
• NifU-like N-terminal domain-containing protein
• NifU-like protein
• NIFUN

Background

Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ISCU
• Uniprot:
  • Q9H1K1(Human)