IRS4 Antibody

Images

 
Immunohistochemistry: IRS4 Antibody [NBP2-14130] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IRS4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEV IFNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPP PVARLLQEEEQERRRPQSRSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IRS4 Protein (NBP2-14130PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IRS4 Antibody

  • insulin receptor substrate 4,160 kDa phosphotyrosine protein
  • IRS-4pp160
  • Phosphoprotein of 160 kDa
  • PY160

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
AF6347
Species: Hu
Applications: WB
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for IRS4 Antibody (NBP2-14130) (0)

There are no publications for IRS4 Antibody (NBP2-14130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRS4 Antibody (NBP2-14130) (0)

There are no reviews for IRS4 Antibody (NBP2-14130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IRS4 Antibody (NBP2-14130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRS4 Products

Bioinformatics Tool for IRS4 Antibody (NBP2-14130)

Discover related pathways, diseases and genes to IRS4 Antibody (NBP2-14130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRS4 Antibody (NBP2-14130)

Discover more about diseases related to IRS4 Antibody (NBP2-14130).
 

Pathways for IRS4 Antibody (NBP2-14130)

View related products by pathway.

PTMs for IRS4 Antibody (NBP2-14130)

Learn more about PTMs related to IRS4 Antibody (NBP2-14130).

Blogs on IRS4

There are no specific blogs for IRS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRS4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRS4