| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IRS1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IRS1 Antibody (NBP2-68666)Find related products by research area.
|
|
Insulin signaling in adipocytes: Carbohydrate-signaling transcription factor ChREBP is the link between lipolytic enzyme Hormone-Sensitive Lipase and lipogenic enzyme ELOVL6 By Jamshed Arslan, Pharm. D., PhD. Insulin resistance in adipocytes is a major feature of metabolic syndrome . Disrupted adipose tissue metabolism can lead to accumulation of lipid intermediates in insul... Read full blog post. |
|
Signalling Advances in Adiponectin Antibody Research Adiponectin is an adipocytokine protein that positively regulates metabolism of lipids and glucose by suppressing glucose production from the liver, stimulating insulin sensitivity, and increasing the rate of fatty acid oxidation and glucose uptake. I... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IRS1 |