IRF9 Antibody

Images

 
Western Blot: IRF9 Antibody [NBP1-81577] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: IRF9 Antibody [NBP1-81577] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IRF9 Antibody [NBP1-81577] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IRF9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLER
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRF9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IRF9 Protein (NBP1-81577PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IRF9 Antibody

  • IFN-alpha-responsive transcription factor subunit
  • interferon regulatory factor 9
  • Interferon-stimulated gene factor 3 gamma
  • interferon-stimulated transcription factor 3, gamma (48kD)
  • interferon-stimulated transcription factor 3, gamma 48kDa
  • IRF9
  • IRF-9
  • ISGF3 p48 subunit
  • ISGF3
  • ISGF3G
  • ISGF3GISGF-3 gamma
  • p48
  • Transcriptional regulator ISGF3 subunit gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-67168
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67330
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB4260
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
42400-1
Species: Mu
Applications: ELISA
NBP2-67634
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF5366
Species: Hu, Mu, Rt
Applications: Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
MAB3427
Species: Hu
Applications: WB
H00003660-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
D6050
Species: Hu
Applications: ELISA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00002520-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-06542
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for IRF9 Antibody (NBP1-81577) (0)

There are no publications for IRF9 Antibody (NBP1-81577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF9 Antibody (NBP1-81577) (0)

There are no reviews for IRF9 Antibody (NBP1-81577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRF9 Antibody (NBP1-81577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IRF9 Products

Bioinformatics Tool for IRF9 Antibody (NBP1-81577)

Discover related pathways, diseases and genes to IRF9 Antibody (NBP1-81577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF9 Antibody (NBP1-81577)

Discover more about diseases related to IRF9 Antibody (NBP1-81577).
 

Pathways for IRF9 Antibody (NBP1-81577)

View related products by pathway.

PTMs for IRF9 Antibody (NBP1-81577)

Learn more about PTMs related to IRF9 Antibody (NBP1-81577).

Blogs on IRF9

There are no specific blogs for IRF9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF9