![Western Blot: IRF4 Antibody (2U3G10) [NBP3-16591] - Western blot analysis of extracts of various cell lines, using IRF4 Rabbit mAb (NBP3-16591) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/IRF4-Antibody-2U3G10-Western-Blot-NBP3-16591-img0001.jpg "Western Blot: IRF4 Antibody (2U3G10) [NBP3-16591] - Western blot analysis of extracts of various cell lines, using IRF4 Rabbit mAb (NBP3-16591) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clone | 2U3G10 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit IRF4 Antibody (2U3G10) (NBP3-16591) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IRF4 (Q15306). MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCA |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | IRF4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IRF4 Antibody (NBP3-16591)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IRF4 |
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Flow Cytometry Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Flow_Cytometry_19328.jpg)
![Western Blot Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Western_Blot_19363.jpg)
![Immunohistochemistry Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Immunohistochemistry_19379.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Western_Blot_5701.jpg)
![Simple Western MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Simple_Western_17120.jpg)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images/af5366_human-mouse-rat-murf1-trim63-affinity-purified-polyclonal-ab-41202412402520.jpg)
![Immunocytochemistry IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-21_AF594_Immunocytochemistry_6525.jpg)
![Neutralization IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/af594_mouse-il-21-affinity-purified-polyclonal-ab-neutralization-249202192915.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")