IRAK1BP1 Antibody - BSA Free

Western Blot: IRAK1BP1 Antibody [NBP2-87636] - Host: Rabbit. Target Name: Irak1bp1. Sample Type: Mouse Testis lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IRAK1BP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IRAK1BP1 Antibody - BSA Free (NBP2-87636) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse IRAK1BP1. Peptide sequence: WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IRAK1BP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IRAK1BP1 Antibody - BSA Free

• ActA binding protein 3,4921528N06Rik
• AIP70
• interleukin-1 receptor-associated kinase 1 binding protein 1
• interleukin-1 receptor-associated kinase 1-binding protein 1
• MGC138458
• MGC138460
• SIMPL

Background

IRAK1BP1 is a component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and isrequired for cell survival. Acts by enhancing RELA transcriptional activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IRAK1BP1